DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6873 and ADF10

DIOPT Version :9

Sequence 1:NP_573321.1 Gene:CG6873 / 32861 FlyBaseID:FBgn0030951 Length:148 Species:Drosophila melanogaster
Sequence 2:NP_568769.1 Gene:ADF10 / 835312 AraportID:AT5G52360 Length:137 Species:Arabidopsis thaliana


Alignment Length:140 Identity:47/140 - (33%)
Similarity:81/140 - (57%) Gaps:9/140 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 ASGINLSRECQHVFEQIRKLKQHRYAVFVIQDEREIKVEVLGVREANYDDFLADLQRAGSNQCRF 66
            |||:.:..||:..|.:::..:.:|:.:|.| |.:::.||.||..:.|||||...|.   .|:||:
plant     5 ASGMAVEDECKLKFLELKAKRNYRFIIFRI-DGQQVVVEKLGSPQENYDDFTNYLP---PNECRY 65

  Fly    67 AVYDYEYQHQCQGTLSTCLKEKLILMLWCPTLARIKDKMLYSSTFAVLKREFPGVQKCIQATEPE 131
            ||||:::.     |.....|.|:..:.|.|..:|::.||:|:|:....|||..|:|..:|||:|.
plant    66 AVYDFDFT-----TAENIQKSKIFFIAWSPDSSRVRMKMVYASSKDRFKRELDGIQVELQATDPS 125

  Fly   132 EACRNAVEEQ 141
            |...:.::.:
plant   126 EMSLDIIKSR 135

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6873NP_573321.1 ADF_cofilin_like 3..142 CDD:200442 46/139 (33%)
ADF10NP_568769.1 ADF_cofilin_like 6..136 CDD:200442 46/139 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 99 1.000 Domainoid score I2370
eggNOG 1 0.900 - - E1_KOG1735
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 108 1.000 Inparanoid score I2088
OMA 1 1.010 - - QHG53544
OrthoDB 1 1.010 - - D1370477at2759
OrthoFinder 1 1.000 - - FOG0000392
OrthoInspector 1 1.000 - - mtm1086
orthoMCL 1 0.900 - - OOG6_100500
Panther 1 1.100 - - O PTHR11913
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X134
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
1312.840

Return to query results.
Submit another query.