DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6873 and ADF9

DIOPT Version :10

Sequence 1:NP_573321.1 Gene:CG6873 / 32861 FlyBaseID:FBgn0030951 Length:148 Species:Drosophila melanogaster
Sequence 2:NP_195223.2 Gene:ADF9 / 829649 AraportID:AT4G34970 Length:141 Species:Arabidopsis thaliana


Alignment Length:142 Identity:42/142 - (29%)
Similarity:85/142 - (59%) Gaps:9/142 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 SGINLSRECQHVFEQIRKLKQHRYAVFVIQDE-REIKVEVLGVREANYDDFLADLQRAGSNQCRF 66
            ||:.::.:|:..|.:::..|.|||.|:.:::: |::.|:.:|....:|||..|.|.   .:.||:
plant     8 SGMWMTDDCKKSFMEMKWKKVHRYVVYKLEEKSRKVTVDKVGAAGESYDDLAASLP---EDDCRY 69

  Fly    67 AVYDYEYQHQCQGTLSTCLKEKLILMLWCPTLARIKDKMLYSSTFAVLKREFPGVQKCIQATEPE 131
            ||:|::|.     |:..|...|:..:.|.|..:||::||:|:::.:.|:|...||...:|||:|.
plant    70 AVFDFDYV-----TVDNCRMSKIFFITWSPEASRIREKMMYATSKSGLRRVLDGVHYELQATDPT 129

  Fly   132 EACRNAVEEQLR 143
            |...:.::::.:
plant   130 EMGFDKIQDRAK 141

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6873NP_573321.1 ADF_cofilin_like 3..142 CDD:200442 42/139 (30%)
ADF9NP_195223.2 ADF_gelsolin 1..141 CDD:472830 42/140 (30%)

Return to query results.
Submit another query.