DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6873 and Dstn

DIOPT Version :9

Sequence 1:NP_573321.1 Gene:CG6873 / 32861 FlyBaseID:FBgn0030951 Length:148 Species:Drosophila melanogaster
Sequence 2:NP_001028838.1 Gene:Dstn / 502674 RGDID:1588366 Length:165 Species:Rattus norvegicus


Alignment Length:160 Identity:47/160 - (29%)
Similarity:81/160 - (50%) Gaps:26/160 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MASGINLSRECQHVF--EQIRK------LKQHRYAV----------FVIQDEREIKVEVLGVREA 47
            ||||:.::.|...:|  .::||      :|:.:.||          .|:::.:||.|..:||...
  Rat     1 MASGVQVADEVCRIFYDMKVRKCSTPEEIKKRKKAVIFCLSADKKCIVVEEGKEILVGDVGVTIT 65

  Fly    48 NYDDFLADLQRAGSNQCRFAVYDYEYQHQCQGTLSTCLKEKLILMLWCPTLARIKDKMLYSSTFA 112
              |.|...:.......||:|:||..::      .....||:|:..||.|..|.:|.||:|:|:..
  Rat    66 --DPFKHFVGMLPEKDCRYALYDASFE------TKESRKEELMFFLWAPEQAPLKSKMIYASSKD 122

  Fly   113 VLKREFPGVQKCIQATEPEEACRNAVEEQL 142
            .:|::|||::...||..||:..|.::.|:|
  Rat   123 AIKKKFPGIKHEYQANGPEDLNRTSIAEKL 152

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6873NP_573321.1 ADF_cofilin_like 3..142 CDD:200442 44/156 (28%)
DstnNP_001028838.1 ADF_cofilin_like 3..152 CDD:200442 44/156 (28%)
Nuclear localization signal. /evidence=ECO:0000255 30..34 1/3 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166354423
Domainoid 1 1.000 64 1.000 Domainoid score I9863
eggNOG 1 0.900 - - E1_KOG1735
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 72 1.000 Inparanoid score I5199
OMA 1 1.010 - - QHG53544
OrthoDB 1 1.010 - - D1370477at2759
OrthoFinder 1 1.000 - - FOG0000392
OrthoInspector 1 1.000 - - mtm9096
orthoMCL 1 0.900 - - OOG6_100500
Panther 1 1.100 - - O PTHR11913
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X134
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
1312.810

Return to query results.
Submit another query.