DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6873 and cfl1

DIOPT Version :9

Sequence 1:NP_573321.1 Gene:CG6873 / 32861 FlyBaseID:FBgn0030951 Length:148 Species:Drosophila melanogaster
Sequence 2:NP_998878.1 Gene:cfl1 / 407855 XenbaseID:XB-GENE-1016481 Length:168 Species:Xenopus tropicalis


Alignment Length:138 Identity:41/138 - (29%)
Similarity:72/138 - (52%) Gaps:22/138 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MASGINLSRECQHVFEQIR---------KLKQHRYAVFVIQDEREIKV-----EVL-GVREANYD 50
            ||||:.:|.:...||..::         ..|:.:..||.:.:::::.:     |:| |....|.|
 Frog     1 MASGVMVSDDVIKVFNDMKVRHQLSPEEAKKRKKAVVFCLSEDKKMIILEPGKEILQGDVGCNVD 65

  Fly    51 D-FLADLQRAGSNQCRFAVYDYEYQHQCQGTLSTCLKEKLILMLWCPTLARIKDKMLYSSTFAVL 114
            | :.|.::....|.||:|:||..|:     |..| .||.|:.:.|.|..|.:|.||:|:|:...:
 Frog    66 DPYKAFVKMLPRNDCRYALYDALYE-----TKET-KKEDLVFVFWAPEEASLKSKMIYASSKDAI 124

  Fly   115 KREFPGVQ 122
            |:.|||::
 Frog   125 KKRFPGIK 132

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6873NP_573321.1 ADF_cofilin_like 3..142 CDD:200442 39/136 (29%)
cfl1NP_998878.1 ADF_cofilin_like 3..153 CDD:200442 39/136 (29%)
Nuclear localization signal. /evidence=ECO:0000255 30..34 1/3 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 64 1.000 Domainoid score I9942
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 74 1.000 Inparanoid score I5107
OMA 1 1.010 - - QHG53544
OrthoDB 1 1.010 - - D1370477at2759
OrthoFinder 1 1.000 - - FOG0000392
OrthoInspector 1 1.000 - - mtm9514
Panther 1 1.100 - - O PTHR11913
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2387
SonicParanoid 1 1.000 - - X134
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
1010.110

Return to query results.
Submit another query.