DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6873 and tsr

DIOPT Version :9

Sequence 1:NP_573321.1 Gene:CG6873 / 32861 FlyBaseID:FBgn0030951 Length:148 Species:Drosophila melanogaster
Sequence 2:NP_477034.1 Gene:tsr / 37841 FlyBaseID:FBgn0011726 Length:148 Species:Drosophila melanogaster


Alignment Length:148 Identity:78/148 - (52%)
Similarity:107/148 - (72%) Gaps:0/148 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MASGINLSRECQHVFEQIRKLKQHRYAVFVIQDEREIKVEVLGVREANYDDFLADLQRAGSNQCR 65
            ||||:.:|..|:..:|:|:|.|:|||.:|.|:||::|.||.:..|.|.||.||.|:|:.|..:||
  Fly     1 MASGVTVSDVCKTTYEEIKKDKKHRYVIFYIRDEKQIDVETVADRNAEYDQFLEDIQKCGPGECR 65

  Fly    66 FAVYDYEYQHQCQGTLSTCLKEKLILMLWCPTLARIKDKMLYSSTFAVLKREFPGVQKCIQATEP 130
            :.::|:||.||||||..:..|:||.||.|||..|::|.||||||:|..||:...||||.||||:.
  Fly    66 YGLFDFEYMHQCQGTSESSKKQKLFLMSWCPDTAKVKKKMLYSSSFDALKKSLVGVQKYIQATDL 130

  Fly   131 EEACRNAVEEQLRSLDRE 148
            .||.|.||||:||:.||:
  Fly   131 SEASREAVEEKLRATDRQ 148

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6873NP_573321.1 ADF_cofilin_like 3..142 CDD:200442 72/138 (52%)
tsrNP_477034.1 ADF_cofilin_like 3..142 CDD:200442 72/138 (52%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45473022
Domainoid 1 1.000 99 1.000 Domainoid score I2370
eggNOG 1 0.900 - - E1_KOG1735
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 108 1.000 Inparanoid score I2088
Isobase 1 0.950 - 0 Normalized mean entropy S1466
OMA 1 1.010 - - QHG53544
OrthoDB 1 1.010 - - D1370477at2759
OrthoFinder 1 1.000 - - FOG0000392
OrthoInspector 1 1.000 - - mtm6541
orthoMCL 1 0.900 - - OOG6_100500
Panther 1 1.100 - - P PTHR11913
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2387
SonicParanoid 1 1.000 - - X134
1413.790

Return to query results.
Submit another query.