DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6873 and cfl1

DIOPT Version :9

Sequence 1:NP_573321.1 Gene:CG6873 / 32861 FlyBaseID:FBgn0030951 Length:148 Species:Drosophila melanogaster
Sequence 2:NP_998806.1 Gene:cfl1 / 321496 ZFINID:ZDB-GENE-030131-215 Length:165 Species:Danio rerio


Alignment Length:137 Identity:39/137 - (28%)
Similarity:68/137 - (49%) Gaps:23/137 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MASGINLSRECQHVFEQIR----------KLKQHRYAVFVIQDER-----EIKVEVLGVREANYD 50
            ||||:.:......||.:::          |.|:.:..:|.:.|::     |...|:|...|.  |
Zfish     1 MASGVTVEETVLTVFNEMKVRKAHCNEEEKSKRKKAVMFCLSDDKKHIIMEQGQEILQGDEG--D 63

  Fly    51 DFLADLQRAGSNQCRFAVYDYEYQHQCQGTLSTCLKEKLILMLWCPTLARIKDKMLYSSTFAVLK 115
            .:|..::....|.||:|:||..|:     |..| .||.|:.:.|.|..|.:|.||:|:|:...:|
Zfish    64 PYLKFVKMLPPNDCRYALYDATYE-----TKET-KKEDLVFIFWAPESAPLKSKMIYASSKDAIK 122

  Fly   116 REFPGVQ 122
            ::|.|::
Zfish   123 KKFTGIK 129

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6873NP_573321.1 ADF_cofilin_like 3..142 CDD:200442 37/135 (27%)
cfl1NP_998806.1 ADF_cofilin_like 3..150 CDD:200442 37/135 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170596730
Domainoid 1 1.000 66 1.000 Domainoid score I9908
eggNOG 1 0.900 - - E1_KOG1735
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 80 1.000 Inparanoid score I5205
OMA 1 1.010 - - QHG53544
OrthoDB 1 1.010 - - D1370477at2759
OrthoFinder 1 1.000 - - FOG0000392
OrthoInspector 1 1.000 - - mtm6541
orthoMCL 1 0.900 - - OOG6_100500
Panther 1 1.100 - - O PTHR11913
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X134
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
1312.810

Return to query results.
Submit another query.