DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6873 and unc-60

DIOPT Version :9

Sequence 1:NP_573321.1 Gene:CG6873 / 32861 FlyBaseID:FBgn0030951 Length:148 Species:Drosophila melanogaster
Sequence 2:NP_503427.2 Gene:unc-60 / 178640 WormBaseID:WBGene00006794 Length:152 Species:Caenorhabditis elegans


Alignment Length:152 Identity:45/152 - (29%)
Similarity:81/152 - (53%) Gaps:6/152 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MASGINLSRECQHVFEQIRKLKQHRYAVFVI-QDEREIKVEVLGVREANYDDFLADLQR--AGSN 62
            ||||:.:...|::.::.:....||.|.:|.| :::..|.||.:|.:.|.|.:|:.::::  ....
 Worm     1 MASGVKVDPSCKNAYDLLHNKHQHSYIIFKIDKNDTAIVVEKVGEKNAPYAEFVEEMKKLVEDGK 65

  Fly    63 QCRFAVYDYEYQHQCQGTLSTCLKEKLILMLWCPTLARIKDKMLYSSTFAVLKREFPGVQKC--I 125
            :||:|..|.|...|.||...|....|:|.:.:||..|.::.:|||:|:...||... |::..  :
 Worm    66 ECRYAAVDVEVTVQRQGAEGTSTLNKVIFVQYCPDNAPVRRRMLYASSVRALKASL-GLESLFQV 129

  Fly   126 QATEPEEACRNAVEEQLRSLDR 147
            ||:|..:....:|:..|.|..|
 Worm   130 QASEMSDLDEKSVKSDLMSNQR 151

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6873NP_573321.1 ADF_cofilin_like 3..142 CDD:200442 40/143 (28%)
unc-60NP_503427.2 ADF_cofilin_like 3..146 CDD:200442 40/143 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C160167801
Domainoid 1 1.000 71 1.000 Domainoid score I6150
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 78 1.000 Inparanoid score I3816
Isobase 1 0.950 - 0 Normalized mean entropy S1466
OMA 1 1.010 - - QHG53544
OrthoDB 1 1.010 - - D1370477at2759
OrthoFinder 1 1.000 - - FOG0000392
OrthoInspector 1 1.000 - - otm14724
orthoMCL 1 0.900 - - OOG6_100500
Panther 1 1.100 - - O PTHR11913
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2387
SonicParanoid 1 1.000 - - X134
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
1413.890

Return to query results.
Submit another query.