DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6873 and Cfl2

DIOPT Version :9

Sequence 1:NP_573321.1 Gene:CG6873 / 32861 FlyBaseID:FBgn0030951 Length:148 Species:Drosophila melanogaster
Sequence 2:NP_031714.1 Gene:Cfl2 / 12632 MGIID:101763 Length:166 Species:Mus musculus


Alignment Length:138 Identity:40/138 - (28%)
Similarity:71/138 - (51%) Gaps:22/138 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MASGINLSRECQHVFE--QIRK------LKQHRYAVF--VIQDEREIKVE------VLGVREANY 49
            ||||:.::.|...||.  ::||      :|:.:.||.  :..|:|:|.||      |..:.:...
Mouse     1 MASGVTVNDEVIKVFNDMKVRKSSTQEEIKKRKKAVLFCLSDDKRQIIVEEAKQILVGDIGDTVE 65

  Fly    50 DDFLADLQRAGSNQCRFAVYDYEYQHQCQGTLSTCLKEKLILMLWCPTLARIKDKMLYSSTFAVL 114
            |.:.:.::....|.||:|:||..|:      .....||.|:.:.|.|..|.:|.||:|:|:...:
Mouse    66 DPYTSFVKLLPLNDCRYALYDATYE------TKESKKEDLVFIFWAPESAPLKSKMIYASSKDAI 124

  Fly   115 KREFPGVQ 122
            |::|.|::
Mouse   125 KKKFTGIK 132

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6873NP_573321.1 ADF_cofilin_like 3..142 CDD:200442 38/136 (28%)
Cfl2NP_031714.1 ADF_cofilin_like 3..153 CDD:200442 38/136 (28%)
Nuclear localization signal. /evidence=ECO:0000255 30..34 1/3 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167850721
Domainoid 1 1.000 65 1.000 Domainoid score I9989
eggNOG 1 0.900 - - E1_KOG1735
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 74 1.000 Inparanoid score I5265
Isobase 1 0.950 - 0 Normalized mean entropy S1466
OMA 1 1.010 - - QHG53544
OrthoDB 1 1.010 - - D1370477at2759
OrthoFinder 1 1.000 - - FOG0000392
OrthoInspector 1 1.000 - - mtm8850
orthoMCL 1 0.900 - - OOG6_100500
Panther 1 1.100 - - O PTHR11913
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2387
SonicParanoid 1 1.000 - - X134
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
1514.790

Return to query results.
Submit another query.