DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6873 and Cfl1

DIOPT Version :9

Sequence 1:NP_573321.1 Gene:CG6873 / 32861 FlyBaseID:FBgn0030951 Length:148 Species:Drosophila melanogaster
Sequence 2:NP_031713.1 Gene:Cfl1 / 12631 MGIID:101757 Length:166 Species:Mus musculus


Alignment Length:150 Identity:40/150 - (26%)
Similarity:72/150 - (48%) Gaps:26/150 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MASGINLSRECQHVFE--QIRK------LKQHRYAV----------FVIQDEREIKVEVLGVREA 47
            ||||:.:|.....||.  ::||      :|:.:.||          .::::.:||.|..:|  :.
Mouse     1 MASGVAVSDGVIKVFNDMKVRKSSTPEEVKKRKKAVLFCLSEDKKNIILEEGKEILVGDVG--QT 63

  Fly    48 NYDDFLADLQRAGSNQCRFAVYDYEYQHQCQGTLSTCLKEKLILMLWCPTLARIKDKMLYSSTFA 112
            ..|.:...::......||:|:||..|:      .....||.|:.:.|.|..|.:|.||:|:|:..
Mouse    64 VDDPYTTFVKMLPDKDCRYALYDATYE------TKESKKEDLVFIFWAPENAPLKSKMIYASSKD 122

  Fly   113 VLKREFPGVQKCIQATEPEE 132
            .:|::..|::..:||...||
Mouse   123 AIKKKLTGIKHELQANCYEE 142

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6873NP_573321.1 ADF_cofilin_like 3..142 CDD:200442 37/147 (25%)
Cfl1NP_031713.1 ADF_cofilin_like 3..153 CDD:200442 37/147 (25%)
Nuclear localization signal. /evidence=ECO:0000255 30..34 1/3 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167850723
Domainoid 1 1.000 65 1.000 Domainoid score I9989
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 74 1.000 Inparanoid score I5265
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53544
OrthoDB 1 1.010 - - D1370477at2759
OrthoFinder 1 1.000 - - FOG0000392
OrthoInspector 1 1.000 - - mtm8850
orthoMCL 1 0.900 - - OOG6_100500
Panther 1 1.100 - - O PTHR11913
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2387
SonicParanoid 1 1.000 - - X134
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
1211.940

Return to query results.
Submit another query.