DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CCKLR-17D1 and CG32547

DIOPT Version :9

Sequence 1:NP_001097021.1 Gene:CCKLR-17D1 / 32860 FlyBaseID:FBgn0259231 Length:673 Species:Drosophila melanogaster
Sequence 2:NP_001259682.1 Gene:CG32547 / 3346150 FlyBaseID:FBgn0052547 Length:1008 Species:Drosophila melanogaster


Alignment Length:495 Identity:96/495 - (19%)
Similarity:176/495 - (35%) Gaps:152/495 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly   182 YSAILLCAVVGNLLVVLTLVQNRRMRTITNVFLLNLAISDILLGVFCMPVTLVGTLLRHFIFGEL 246
            |:|:.|..||.|:::|:.::.:|..:.:|:.|::|||:...:.....:||:|:..|::::|||:.
  Fly   108 YAALALLGVVLNVIIVVYIMYHRLYKDVTHAFIINLALCHFVQCALVLPVSLMVMLIQNWIFGQF 172

  Fly   247 LCKLIQFAQAASVAVSSWTLVAISCERYYAICHPLRSR---------TWQTINHANKIIAIIWLG 302
            ||..:...|...:.|:..:.:.|:.:|...:..||:.|         ||.|    ..:||:.:  
  Fly   173 LCFFLPMLQDIPLHVAMISHILIAWDRMRWLNDPLKGRLPGFVCCCATWLT----GMVIALPY-- 231

  Fly   303 SLVCMTPI----AAFSQLMPTSRPGLRKCREQWPADSLNYERAYNLFLDLALLVLPLLALSFTYL 363
                  ||    ......|| ...|:..|......|...|.|.    |.|.:...|.:.||:.|:
  Fly   232 ------PIYTIYVELGDYMP-QLSGIGLCVVNLMDDMQEYTRG----LFLLMYCGPAILLSYLYI 285

  Fly   364 FITRTL-------YVSMRNERA------MNFGSSGPEVTTSSSAAVA----EAGSQRRANGSHCQ 411
            ..::.|       .|.|...||      .|..:|..|....|...||    ..|:..|:...:..
  Fly   286 RTSQELRPPDGPFAVMMYEHRADLRMRQRNSSTSSVEPRHLSGGGVAGLSNGGGNSARSYDLYSA 350

  Fly   412 SLDTIVPHQHNPHQQHH---------------------------HHSQYYYDYGH---------- 439
            .||.   |:....|::.                           :.:..::|:.:          
  Fly   351 ELDV---HREKRKQRNFGSMAATQVVCMCPLMILRFARLSLEETYENAKHFDFTYLMFVWVAFLP 412

  Fly   440 -----CGSKRRLISGGGPCEGRRHL--YCMRSASVKSLRHQQINGGGGTLSGTGAGNGE------ 491
                 |....:::    |.:.:..|  |...|:..|....::.:.|||  ||.|..:.|      
  Fly   413 TVIFPCIYASQIL----PRDEQERLRGYFRLSSKRKQKSQRRSDAGGG--SGVGGSSREDSIEKD 471

  Fly   492 ---CCSRVH----------RMRQQMQLQQQGYVS------------------------------- 512
               ..:.||          ::|.:.:::..|:.|                               
  Fly   472 EASNTTSVHHAAEPHKHSSKLRHEREVRLPGHGSSAGGDRYTGAPYRQGKDRERERERDRDRERD 536

  Fly   513 -DNESRRKSLSQPSLRITEAGLRRSNETKSLESKKRVVKM 551
             |.|..|:..........:||: .:|..|.:..||..||:
  Fly   537 RDRERERERQRAGGRGAGDAGV-VNNLGKDVRGKKHDVKI 575

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CCKLR-17D1NP_001097021.1 7tm_4 185..>308 CDD:304433 32/131 (24%)
7tm_1 192..>380 CDD:278431 49/213 (23%)
CG32547NP_001259682.1 7TM_GPCR_Srd 104..>195 CDD:304638 24/86 (28%)
7tm_1 119..>292 CDD:278431 44/189 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24238
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.