DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CCKLR-17D1 and R13H4.7

DIOPT Version :9

Sequence 1:NP_001097021.1 Gene:CCKLR-17D1 / 32860 FlyBaseID:FBgn0259231 Length:673 Species:Drosophila melanogaster
Sequence 2:NP_001256380.1 Gene:R13H4.7 / 187874 WormBaseID:WBGene00011265 Length:347 Species:Caenorhabditis elegans


Alignment Length:265 Identity:69/265 - (26%)
Similarity:111/265 - (41%) Gaps:72/265 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly   185 ILLCAVVGNLLVVLTLVQNRRMRTITNV----FLLNLAISDILL----GVFCMPVTLVGTLLRHF 241
            :||..:||..|..|.:....||  :..:    ||::.|::||||    |::  |..::  |.::.
 Worm    12 LLLFGIVGCALYGLIVCSMWRM--VNEIVGFRFLISQALTDILLMIQFGIW--PGIVI--LTQNE 70

  Fly   242 IFGE-------LLCKLIQFAQAASVAVSSWTLVAISCERYYAICHPLRSRTW-QTINHANKII-- 296
            |..|       :......:|......|.:|:.:|       |:..|    .| :|:.|...|:  
 Worm    71 IINESWRWNIHIYLDFTWWAMVYHYTVIAWSRLA-------AVQWP----NWFRTLPHGTSIMIC 124

  Fly   297 AIIW----LGSLV-----CMTPIAAFSQLMPTSRPGLRKCREQWPADSLNYERAYNLFLDLALLV 352
            ||.|    |.|||     ..||:.    ..|| |.|:   ...|....|:....|.:..::.|:|
 Worm   125 AIPWFTGLLQSLVEHQFDWFTPLF----YSPT-RYGM---HSDWEKYELSGTNTYYMVCNVILMV 181

  Fly   353 L--PLLALSFTYLFITRTLYVSMRNERAMNFGSSGPEVTTSSSAAVAEAGSQRRANGSHCQSLDT 415
            :  ||..|:...||..:|    .||.:..:..|..| ::|||.||     .||:.      |::|
 Worm   182 VPFPLYVLALAVLFQRQT----SRNMQLRSKYSHAP-ISTSSYAA-----QQRQL------SIET 230

  Fly   416 --IVP 418
              :||
 Worm   231 RLLVP 235

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CCKLR-17D1NP_001097021.1 7tm_4 185..>308 CDD:304433 37/149 (25%)
7tm_1 192..>380 CDD:278431 53/216 (25%)
R13H4.7NP_001256380.1 7tm_GPCRs 6..283 CDD:333717 69/265 (26%)
TM helix 1 6..29 CDD:320095 6/16 (38%)
TM helix 2 40..63 CDD:320095 9/24 (38%)
TM helix 3 79..100 CDD:320095 2/20 (10%)
TM helix 4 122..143 CDD:320095 7/20 (35%)
TM helix 5 169..192 CDD:320095 6/22 (27%)
TM helix 7 258..283 CDD:320095
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24238
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.