DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cyp308a1 and Cyp6a9

DIOPT Version :9

Sequence 1:NP_573320.1 Gene:Cyp308a1 / 32859 FlyBaseID:FBgn0030949 Length:490 Species:Drosophila melanogaster
Sequence 2:NP_523748.2 Gene:Cyp6a9 / 36663 FlyBaseID:FBgn0013771 Length:504 Species:Drosophila melanogaster


Alignment Length:525 Identity:137/525 - (26%)
Similarity:232/525 - (44%) Gaps:67/525 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MLPLVLFILLAATLLFWKWQGNHWRRLGLEAPFGWPLVGNMLDFALGRRSYGEIYQEIYTRNPGL 65
            :|..::.:|:...||.|:...::|:.|.:.......|:|::...... ||:..|:.:.|.:..|.
  Fly     6 VLLAIVVVLVGYLLLKWRRALHYWQNLDIPCEEPHILMGSLTGVQTS-RSFSAIWMDYYNKFRGT 69

  Fly    66 -KYVGFYRLFNEPAILVRDQELLRQILVGRNFADCADNAVYVDHQRDVLASHNPFIANGDRWRVL 129
             .:.||| .|..|.|||.|..|.:.||: :.|....|...|.:.:.|.| |...|:.:|.:|:.:
  Fly    70 GPFAGFY-WFQRPGILVLDISLAKLILI-KEFNKFTDRGFYHNTEDDPL-SGQLFLLDGQKWKSM 131

  Fly   130 RADLVPLFTPSRVRQTLPHVARACQ-------LLRDQVPLGRFEAKDLATRYTLQVVASAIFGLD 187
            |:.|...||..:::...|.|.:...       ...::.|:  .|.:|:..|:|..|:.:..||::
  Fly   132 RSKLSYTFTSGKMKYMFPTVVKVGHEFIEVFGQAMEKSPI--VEVRDILARFTTDVIGTCAFGIE 194

  Fly   188 AHCL---GIHMRVAHEPSRWLEWLAPL---FQPSVWSLLETMSLLHTPRLGRLIGHRYVPL-PLQ 245
            ...|   ....||....:.:.:...|:   |..|..:|...:             |..:.| ..:
  Fly   195 CSSLKDPEAEFRVMGRRAIFEQRHGPIGIAFINSFQNLARRL-------------HMKITLEEAE 246

  Fly   246 HWF----RELVEARSGG--------DNLLQW----LAESKRG----LGKEELAGHATTLLLEGYE 290
            |:|    ||.|..|...        |.|:..    |.:|:.|    |..||:|..|......|:|
  Fly   247 HFFLRIVRETVAFREKNNIRRNDFMDQLIDLKNSPLTKSESGESVNLTIEEMAAQAFVFFGAGFE 311

  Fly   291 TSAMLLAFALYELALNEDAQRRLHIELDEVAQRHAGNLIDPVALGELRYSEAALLEALRLHPAMQ 355
            ||:..:.|||||||.::|.|.|:..|..||..::.|. |...::.::.|.:..:.|.|||:..:.
  Fly   312 TSSTTMGFALYELAQHQDIQDRVRKECQEVIGKYNGE-ITYESMKDMVYLDQVISETLRLYTVLP 375

  Fly   356 ALQKRCTKTFTLPDQKSGASSELKVHLGTVLVLPVQAIHLDPALYPAPNQFRPERFLNQPPM--- 417
            .|.:.|.:.:.:|     ...:..:..|..:::|..|:|.|..||..||.|.|:.|  .|..   
  Fly   376 VLNRECLEDYEVP-----GHPKYVIKKGMPVLIPCGAMHRDEKLYANPNTFNPDNF--SPERVKE 433

  Fly   418 --GCRFLGFGAGPRMCPGMRLGLLQTKAALTTLLQDHCVQLADEDQCRVEVSPLTFLTASRNGIW 480
              ...:|.||.|||.|.|||.|.:|.::.|..|:......:.::....:..|..|||.:|..||:
  Fly   434 RDSVEWLPFGDGPRNCIGMRFGQMQARSGLALLINRFKFSVCEQTTIPIVYSKKTFLISSETGIF 498

  Fly   481 LSFKR 485
            |..:|
  Fly   499 LKVER 503

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cyp308a1NP_573320.1 p450 32..481 CDD:299894 128/488 (26%)
Cyp6a9NP_523748.2 p450 35..499 CDD:278495 128/490 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45460932
Domainoid 1 1.000 88 1.000 Domainoid score I2119
eggNOG 1 0.900 - - E2759_KOG0158
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 88 1.000 Inparanoid score I1773
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D264519at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24292
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X40
87.900

Return to query results.
Submit another query.