DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cyp308a1 and cyp-25A6

DIOPT Version :9

Sequence 1:NP_573320.1 Gene:Cyp308a1 / 32859 FlyBaseID:FBgn0030949 Length:490 Species:Drosophila melanogaster
Sequence 2:NP_001360017.1 Gene:cyp-25A6 / 187059 WormBaseID:WBGene00019438 Length:235 Species:Caenorhabditis elegans


Alignment Length:214 Identity:38/214 - (17%)
Similarity:94/214 - (43%) Gaps:47/214 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MLPLVLFILLAATLLFWKWQGNHWRRLGLEAPFGWPLVGNMLDFALGRRSYGEIYQEIYTRNPGL 65
            ::..:::::||....| :.:|    ::||..|....|:||:              ::|..|...|
 Worm    13 LVSFIIYVILARKERF-RLRG----KIGLSGPEPHWLMGNL--------------KQIIERKAKL 58

  Fly    66 KYVGFYRLFN----------------EPAILVRDQELLRQILVGRNFADCADNA---VYVDHQRD 111
            .|...|..:|                :..|.:.::|.::::.: :||::.:|..   :..|::..
 Worm    59 GYDDSYDWYNKLHKQFGETFGIYFGTQLNINITNEEDIKEVFI-KNFSNFSDRTPPPIIEDNKLK 122

  Fly   112 VLASHNPFIANGDRWRVLRADLVPLFTPSRVR---QTL-PHVARACQLLRDQVPLG-RFEAKDLA 171
            .....|.:.:.   |:..|:.:.|:|:..:::   :|: ..|....::|:::...| :::..|..
 Worm   123 ESLLQNTYESG---WKHTRSAIAPIFSTGKMKAMHETIHSKVDLFLEILKEKASSGQKWDIYDDF 184

  Fly   172 TRYTLQVVASAIFGLDAHC 190
            ...||.|:....|.:|::|
 Worm   185 QGLTLDVIGKCAFAIDSNC 203

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cyp308a1NP_573320.1 p450 32..481 CDD:299894 32/183 (17%)
cyp-25A6NP_001360017.1 p450 37..>215 CDD:386267 32/185 (17%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0158
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D264519at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.