DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cyp18a1 and AT1G66540

DIOPT Version :9

Sequence 1:NP_523403.2 Gene:Cyp18a1 / 32858 FlyBaseID:FBgn0010383 Length:538 Species:Drosophila melanogaster
Sequence 2:NP_176827.2 Gene:AT1G66540 / 842972 AraportID:AT1G66540 Length:386 Species:Arabidopsis thaliana


Alignment Length:392 Identity:103/392 - (26%)
Similarity:178/392 - (45%) Gaps:61/392 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly   140 WKDQRR------FLHDKLRQFGMTYMGNGKQQMQKRIMTEVHEFIGHLHAS-----DGQPVDMSP 193
            |::.||      |.:.:|..|          ...:|  .|:...|..|..|     :...|:|:.
plant    10 WRNLRRIGAVEIFSNHRLNSF----------YTIRR--DEIRRLIARLSRSPNASLEFAKVEMNS 62

  Fly   194 VIS-VAVSNVICSLMMSTRF---SIDDPKFRRFNFLIEEGMRLFGEIHTVDYIPTMQCFPSISTA 254
            ::| :|.:|:|..:.....:   :.|||:.:|...||.|.|..||..|..|::|.::........
plant    63 MLSNLAFNNIIRMVTGKCYYGDGAEDDPEAKRVRQLIAEAMSCFGAGHAADHLPMLRWITDFERR 127

  Fly   255 KNKIAQNRAEMQRFYQDVIDDHKRSFDPNNIRDLVDFYLCEIEKAKAEGTDAELFDGKNHEEQLV 319
            ..|||   |.:..|:|.::|: ||.........::| :|..::.::.|........|        
plant   128 VKKIA---ARLDEFFQRLVDE-KRVAKEKKENTMID-HLLSLQVSQPEYYTDHTIKG-------- 179

  Fly   320 QVIIDLFSAGMETIKTTLLWINVFMLRNPKEMRRVQDELDQVVGRHRLPTIEDLQYLPITESTIL 384
             .::.|..||.:|...||.|....:|.||:.:::|:||:|..:|..||....|:..||..::.:.
plant   180 -TMLSLILAGTDTSAVTLEWALSSLLNNPEVLKKVRDEIDNQIGLDRLLEESDIPNLPYLQNIVS 243

  Fly   385 ESMRRSSIVPLATTHSPTRDVELNGYTIPAGSHVIPLINSVHMDPNLWEKPEEFRPSRFIDTEGK 449
            |::|.....||...|..:.|.::.||.:|.|:.::..:.::|.||.||:.|..|:|.|| :.||:
plant   244 ETLRLYPAGPLLVPHISSEDCKVGGYDMPCGTMLLVNVWAIHRDPRLWDDPASFKPERF-EKEGE 307

  Fly   450 VRKPEYFIPFGVGRRMCLGDVLARMELFLFFASFMHCFD----------------IALPEGQPLP 498
            ..|   .:.||:|||.|.|..|||..:.|...|.:.||:                :.:|...||.
plant   308 THK---LLTFGLGRRACPGSGLARRLVSLSLGSLIQCFEWERIGEEEVDMTEGGGLTMPRAIPLV 369

  Fly   499 SL 500
            ::
plant   370 AM 371

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cyp18a1NP_523403.2 p450 54..517 CDD:278495 103/392 (26%)
AT1G66540NP_176827.2 p450 <4..375 CDD:386267 103/392 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X6
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.