DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cyp18a1 and CYP703A2

DIOPT Version :9

Sequence 1:NP_523403.2 Gene:Cyp18a1 / 32858 FlyBaseID:FBgn0010383 Length:538 Species:Drosophila melanogaster
Sequence 2:NP_171635.1 Gene:CYP703A2 / 839470 AraportID:AT1G01280 Length:510 Species:Arabidopsis thaliana


Alignment Length:527 Identity:142/527 - (26%)
Similarity:234/527 - (44%) Gaps:65/527 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    26 LLMVFLGLLALVTLLQWLVRNYRELRKLPPGPWGLPVIGYLLFMGSEKHTRFMELAKQYGSLFST 90
            |..:|..|:..|.|.:||..:..:.::|||||..||::|.||.:|...|.....|..:||.|...
plant     5 LASLFAVLILNVLLWRWLKASACKAQRLPPGPPRLPILGNLLQLGPLPHRDLASLCDKYGPLVYL 69

  Fly    91 RLGSQLTVVMSDYKMIRECFRREE--FTGRPDTPFMQTLNGYG----IINSTGKLWKDQRRFLHD 149
            |||:...:..:|...|||...|::  |:.||.|.....| .||    .:...|..||..||...:
plant    70 RLGNVDAITTNDPDTIREILLRQDDVFSSRPKTLAAVHL-AYGCGDVALAPMGPHWKRMRRICME 133

  Fly   150 ------KLRQFGMTYMGNGKQQMQKRIMTEVHEFIGHLHASDGQPVDMSPVISVAVSNVICSLMM 208
                  :|..|     ...:.:..:.::.:|.:     .:..|:|:::..|:.....|.:..:::
plant   134 HLLTTKRLESF-----TTQRAEEARYLIRDVFK-----RSETGKPINLKEVLGAFSMNNVTRMLL 188

  Fly   209 STRF----SIDDPK-FRRFNFLIEEGMRLFGEIHTVDYIPTMQCF-PSISTAKNKIAQNRAEMQR 267
            ..:|    |:..|| .:.|..:..:...|.|.|:..||:|..:.. ||....:.:..:.|.:  .
plant   189 GKQFFGPGSLVSPKEAQEFLHITHKLFWLLGVIYLGDYLPFWRWVDPSGCEKEMRDVEKRVD--E 251

  Fly   268 FYQDVIDDHKRS----FDPNNIRDLVDFYL-CEIEKAKAEGTDAELFDGKNHEEQLVQVIIDLFS 327
            |:..:||:|:|:    .|.|...|.||..| ...|..||...|.|:       :.|:|   |:.:
plant   252 FHTKIIDEHRRAKLEDEDKNGDMDFVDVLLSLPGENGKAHMEDVEI-------KALIQ---DMIA 306

  Fly   328 AGMETIKTTLLWINVFMLRNPKEMRRVQDELDQVVGRHRLPTIEDLQYLPITESTILESMRRSSI 392
            |..:|...|..|.....::.|:.||::|:|||.|||.:|:....||.:|......:.|:.|....
plant   307 AATDTSAVTNEWAMAEAIKQPRVMRKIQEELDNVVGSNRMVDESDLVHLNYLRCVVRETFRMHPA 371

  Fly   393 VPLATTHSPTRDVELNGYTIPAGSHVIPLINSVHMDPNLWEKPEEFRPSRFIDTEGKVR-----K 452
            .|....|...|...:|||.|||.:.|....:.:..:..:|:..|:|||.|....||..|     .
plant   372 GPFLIPHESVRATTINGYYIPAKTRVFINTHGLGRNTKIWDDVEDFRPERHWPVEGSGRVEISHG 436

  Fly   453 PEY-FIPFGVGRRMCLGDVLARMELFLFFASFMHCFDIALPEGQPLPSLKGNVGATITPESFKVC 516
            |:: .:||..|:|.|.|..|....:.:..|...|||:.:.|         ||:.   |.|.:.:.
plant   437 PDFKILPFSAGKRKCPGAPLGVTMVLMALARLFHCFEWSSP---------GNID---TVEVYGMT 489

  Fly   517 L-KRRPL 522
            : |.:||
plant   490 MPKAKPL 496

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cyp18a1NP_523403.2 p450 54..517 CDD:278495 131/491 (27%)
CYP703A2NP_171635.1 PLN03112 1..510 CDD:215583 142/527 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 186 1.000 Domainoid score I986
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 192 1.000 Inparanoid score I1368
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X6
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
44.050

Return to query results.
Submit another query.