DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cyp18a1 and CYP71B28

DIOPT Version :9

Sequence 1:NP_523403.2 Gene:Cyp18a1 / 32858 FlyBaseID:FBgn0010383 Length:538 Species:Drosophila melanogaster
Sequence 2:NP_172768.1 Gene:CYP71B28 / 837866 AraportID:AT1G13090 Length:490 Species:Arabidopsis thaliana


Alignment Length:497 Identity:132/497 - (26%)
Similarity:233/497 - (46%) Gaps:60/497 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    27 LMVFLGLLALVTLLQWLVRNYRELR-KLPPGPWGLPVIGYLLFMGSEKHTR-FMELAKQYGSLFS 89
            :.|||..|.|:.|:...::|.:..: ||||||..||:||. |....|.|.| ...|:::||.:..
plant     1 MSVFLCFLCLLPLILIFLKNLKPSKWKLPPGPKKLPIIGN-LHQRRELHPRNSRNLSEKYGPIVF 64

  Fly    90 TRLGSQLTVVMSDYKMIRECFRRE--EFTGRPDTPFMQTLN------GYGIINSTGKLWKDQRR- 145
            .|.|....||:|..:...|..:..  |...||:|...:.::      |:.   ..|:.|:..|: 
plant    65 LRYGFVPVVVISSKEAAEEVLKTHDLECCSRPETVGTRAISYNFKDIGFA---PYGEDWRTMRKL 126

  Fly   146 -----FLHDKLRQFGMTYMGNGKQQMQKRIMTEVHEFIGHLHASDGQPVDMSPVISVAVSNVICS 205
                 |...||:.|  .|:...:..:..:.::::        ||....|::...:...|.:::|.
plant   127 SVVELFSSKKLQSF--RYIREEENDLCVKKLSDL--------ASRRSLVNLEKTLFTLVGSIVCR 181

  Fly   206 L-----MMSTRF----SIDDPKFRRFNFLIEEGMRLFGEIHTVDYIPTM--QCFPSISTAKNKIA 259
            :     :....|    ||||        |:.:...:.......|:.|.:  :....|.:.:.::.
plant   182 IGFGINLRECEFVDEDSIDD--------LVHKSEDVIRNSIFSDFFPGLMGRLIEWIFSERKRLN 238

  Fly   260 QNRAEMQRFYQDVIDDHKRSFDPNNIRDLVDFYLCEIEKAKAEGTDAELFDGKNHEEQLVQVIID 324
            :..:|:..|:|:::|||.:....::  |::|..:..::|.:.|| |:..|.    .:.|..:|.|
plant   239 RLYSEVDTFFQNILDDHLKPGRESS--DIIDVMIDMMKKQEKEG-DSFKFT----TDHLKGMISD 296

  Fly   325 LFSAGMETIKTTLLWINVFMLRNPKEMRRVQDELDQVVG--RHRLPTIEDLQYLPITESTILESM 387
            :|.||:.|..|||:|....::|||:.|::||||:...:|  :.|: |.|||..|...:..:.|..
plant   297 IFLAGVGTSSTTLIWAMTELIRNPRVMKKVQDEIRTTLGDKKERI-TEEDLNQLHYFKLMVKEIF 360

  Fly   388 RRSSIVPLATTHSPTRDVELNGYTIPAGSHVIPLINSVHMDPNLWEKPEEFRPSRFIDTEGKVRK 452
            |.....||.........|::.||.|||.:.::....::..||.||..|:||.|.||:|:....|.
plant   361 RLHPAAPLLLPRETLSHVKIQGYDIPAKTQIMINAYAIARDPKLWTNPDEFNPDRFLDSSIDYRG 425

  Fly   453 PEY-FIPFGVGRRMCLGDVLARMELFLFFASFMHCFDIALPE 493
            ..: .:|||.|||:|.|..:....:.|...:.::.||..|||
plant   426 LNFELLPFGSGRRICPGMTMGIAIVELGLLNLLYFFDWGLPE 467

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cyp18a1NP_523403.2 p450 54..517 CDD:278495 123/469 (26%)
CYP71B28NP_172768.1 CYP71-like 58..474 CDD:410695 110/439 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100036
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X6
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.900

Return to query results.
Submit another query.