DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cyp18a1 and CYP71B2

DIOPT Version :9

Sequence 1:NP_523403.2 Gene:Cyp18a1 / 32858 FlyBaseID:FBgn0010383 Length:538 Species:Drosophila melanogaster
Sequence 2:NP_172767.1 Gene:CYP71B2 / 837865 AraportID:AT1G13080 Length:502 Species:Arabidopsis thaliana


Alignment Length:500 Identity:135/500 - (27%)
Similarity:231/500 - (46%) Gaps:61/500 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    26 LLMVFLGLLALVTLLQ--WLVRNYRELRKLPPGPWGLPVIGYLLFMGSEKHTRFMELAKQYGSLF 88
            :|:.|. |::|:|::.  :|.:|......|||.|..||:||.|..:....|..|.:|:.:||.|.
plant     3 ILLCFF-LVSLLTIVSSIFLKQNKTSKFNLPPSPSSLPIIGNLHHLAGLPHRCFHKLSIKYGPLV 66

  Fly    89 STRLGSQLTVVMSDYKMIRECFRRE--EFTGRPDTPFMQTLNGYGIINST----GKLWKDQRR-- 145
            ..||||...||:|..:......:..  |...||.|.....|: ||..:.|    |:.|::.|:  
plant    67 FLRLGSVPVVVISSSEAAEAVLKTNDLECCSRPKTVGSGKLS-YGFKDITFAPYGEYWREVRKLA 130

  Fly   146 ----FLHDKLRQFGMTYMGNGKQQMQKRIMTEVHEFIGHLHASDGQPVDMSPVISVAVSNVICSL 206
                |...|::.|  .|:   :::....::.:|.|     .|....|||:|.......:::||.:
plant   131 VIELFSSKKVQSF--RYI---REEEVDFVVKKVSE-----SALKQSPVDLSKTFFSLTASIICRV 185

  Fly   207 MMSTRFS-----IDDPKFRRFNFLIEEGMRLFGEIHTVDYIP---------TMQCFPSISTAKNK 257
            .:...|:     ||..   |...|:.|.....|.....|:.|         ..|....|    ||
plant   186 ALGQNFNESGFVIDQD---RIEELVTESAEALGTFTFSDFFPGGLGRFVDWLFQRHKKI----NK 243

  Fly   258 IAQNRAEMQRFYQDVIDDHKRSFDPNNIRDLVDFYLCEIEKAKAEGTDAELFDGKNHEEQLVQVI 322
            :.:   |:..|||.|||||.:.....| :|:|...|..|:|.:    |::.|  |.:.:.|..::
plant   244 VFK---ELDAFYQHVIDDHLKPEGRKN-QDIVTLILDMIDKQE----DSDSF--KLNMDNLKAIV 298

  Fly   323 IDLFSAGMETIKTTLLWINVFMLRNPKEMRRVQDELDQVVG--RHRLPTIEDLQYLPITESTILE 385
            :|:|.||::|...|::|....::|||:.|::.|:.:...:|  :.|: |.|||..:......:.|
plant   299 MDVFLAGIDTSAVTMIWAMTELIRNPRVMKKAQESIRTTLGLKKERI-TEEDLGKVEYLNHILKE 362

  Fly   386 SMRRSSIVPLATTHSPTRDVELNGYTIPAGSHVIPLINSVHMDPNLWEKPEEFRPSRFIDTEGKV 450
            :.|....:|..........:::.||.||..:.:...:.::..||..|..||||.|.||.::....
plant   363 TFRLHPALPFVVPRETMSHIKIQGYDIPPKTQIQLNVWTIGRDPKRWNDPEEFNPERFANSSVDF 427

  Fly   451 RKPEY-FIPFGVGRRMCLGDVLARMELFLFFASFMHCFDIALPEG 494
            |...: .:|||.|||:|.|..:|...:.|...:.::.||.::|:|
plant   428 RGQHFDLLPFGSGRRICPGMPMAIASVELALMNLLYYFDWSMPDG 472

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cyp18a1NP_523403.2 p450 54..517 CDD:278495 126/469 (27%)
CYP71B2NP_172767.1 p450 5..500 CDD:386267 133/497 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X6
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.000

Return to query results.
Submit another query.