DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cyp18a1 and CYP71A18

DIOPT Version :9

Sequence 1:NP_523403.2 Gene:Cyp18a1 / 32858 FlyBaseID:FBgn0010383 Length:538 Species:Drosophila melanogaster
Sequence 2:NP_001184964.1 Gene:CYP71A18 / 837705 AraportID:AT1G11610 Length:504 Species:Arabidopsis thaliana


Alignment Length:535 Identity:144/535 - (26%)
Similarity:235/535 - (43%) Gaps:99/535 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    27 LMVFLGLLALVTLL---QWLVRNYRELRKLPPGPWGLPVIGYLLFMGSEKHTRFMELAKQYGSLF 88
            |||.|.|..|:|||   ::|.|..::: .|||.||.:||||.|..:....|.....|:.:||.|.
plant     5 LMVSLCLTTLLTLLLLKKFLKRTAKKV-NLPPSPWRIPVIGNLHQLSLHPHRSLHSLSLRYGPLM 68

  Fly    89 STRLGSQLTVVMSDYKMIRECFRREE--FTGRPDTPFMQTLNGYG---IINSTGKLWKDQRRFL- 147
            ....|....:|:|..:...|..:..:  |..||.:..:..|...|   :....|:.|:..:... 
plant    69 LLHFGRVPILVVSSSEAAHEILKTHDLKFANRPKSKAVHGLMNGGRDVVFGPYGEYWRQMKSVCI 133

  Fly   148 -----------HDKLRQFGMTYMGNGKQQMQKRIMTEVHEFIGHLHASDGQPVDMSPVISVAVSN 201
                       .:|:|:..:..|   .::::|...:...|             ::|.:.....|:
plant   134 LNLLTNKMVASFEKVREEEVNAM---MEKLEKASCSSSAE-------------NLSELFVTLTSD 182

  Fly   202 VICSLMMSTRFSIDDP----KFRRFNFLIEEGMRLFGEIHTVDYIPTMQCFPSISTAKNKIAQNR 262
            |...:.:..::..|:.    |.|     :.:.|.|..|....||:|.:.....|:...:||    
plant   183 VTSRVSLGKKYWEDETAGGLKKR-----VRQIMELLREFPIGDYVPALAWIDRINGFNSKI---- 238

  Fly   263 AEMQRFYQDVID----------DHKRSFDPNNIRDLVDFYLCEIEKAKAEGTDAELFDGKNHEEQ 317
            .|:.|.|.|:::          :||..|  .||       |..|||.|..|...:..|.|     
plant   239 VEVSRAYSDLMEKVVQEHLEAGEHKADF--VNI-------LLSIEKEKNNGFKVQRNDIK----- 289

  Fly   318 LVQVIIDLFSAGMETIKTTLLWINVFMLRNPKEMRRVQDELDQVVGRH----RLPTIEDLQYLPI 378
              .:|:|:|..|:.|..|.|.||...::|||:.|:::|:|:...:..|    :...:|:::||  
plant   290 --FMILDMFIGGISTSSTLLEWIMTELIRNPECMKKLQNEIRSTIRPHGSYIKEKEVENMRYL-- 350

  Fly   379 TESTILESMRRSSIVPLATTHSPTRDVELNGYTIPAGSHVIPLIN--SVHMDPNLW-EKPEEFRP 440
             ::.|.|..|....:||......|.||::.||.|.||:.|  |||  |:|.||.:| ...|||:|
plant   351 -KAVIKEVFRVHPPLPLILPRLLTEDVKVKGYDIAAGTEV--LINAWSIHRDPAIWGPDAEEFKP 412

  Fly   441 SRFIDT----EGKVRKPEYFIPFGVGRRMCLGDVLARMELFLFFASFMHCFDIAL---PEGQPLP 498
            .|.:|:    .|:..|   :||||.|||:|.|..||...:.:..|:.:..||.::   |.|.. |
plant   413 ERHLDSTLDYHGQDLK---YIPFGSGRRICPGINLAMGLVEVTLANLVGRFDWSVDPGPNGDQ-P 473

  Fly   499 SLKGNVGATITPESF 513
            .|..:.|..|..:.|
plant   474 DLAEDFGLDIPKKVF 488

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cyp18a1NP_523403.2 p450 54..517 CDD:278495 132/505 (26%)
CYP71A18NP_001184964.1 p450 26..496 CDD:299894 134/514 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X6
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.