DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cyp18a1 and CYP71B8

DIOPT Version :9

Sequence 1:NP_523403.2 Gene:Cyp18a1 / 32858 FlyBaseID:FBgn0010383 Length:538 Species:Drosophila melanogaster
Sequence 2:NP_680342.2 Gene:CYP71B8 / 833546 AraportID:AT5G35715 Length:442 Species:Arabidopsis thaliana


Alignment Length:408 Identity:95/408 - (23%)
Similarity:170/408 - (41%) Gaps:38/408 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly   144 RRFLHDKLRQFGMTYMGNGKQQMQKRIMTEV-----HEFIGHLHASDGQ--------------PV 189
            |.|......|:|..:     ::|:|.:..|:     |:|..::...:|.              .|
plant    44 RNFKDIAFAQYGEDW-----REMKKLVGLELFNPKKHKFFRYIREEEGDLLVKKLSKSSQTQTLV 103

  Fly   190 DMSPVISVAVSNVICSLMMSTRF-SIDDPKFRRFNFLIEEGMRLFGEIHTVDYIPT--MQCFPSI 251
            |:........:.:|..:.....| ..|.....|...|::|...........|:.||  ......|
plant   104 DLRKAFFSFTAGIIFRVSFGQNFRECDFIDMDRLEELVQESETNVFSFAFTDFFPTGLGWLVDRI 168

  Fly   252 STAKNKIAQNRAEMQRFYQDVIDDHKRSFDPNNIRDLVDFYLCEIEKAKAEGTDAELFDGKNHEE 316
            |...::|.:..:::.:|:|.|||:..:.....:..:||...|..|.::...|:      .|...:
plant   169 SGQHSRIEKAFSKLTKFFQHVIDEELKIGQSQDHSNLVSSMLDMINRSTEYGS------FKITSD 227

  Fly   317 QLVQVIIDLFSAGMETIKTTLLWINVFMLRNPKEMRRVQDELDQVVG--RHRLPTIEDLQYLPIT 379
            .|:.::.|:...|:.....|::|....:.|:|:.|:::::|:...:|  :.|: |.|||:.:...
plant   228 HLIAMMTDIVLGGVNAGTITMIWTMTELTRHPRVMKKLREEIRATLGPNKERI-TEEDLEKVEYL 291

  Fly   380 ESTILESMRRSSIVPLATTHSPTRDVELNGYTIPAGSHVIPLINSVHMDPNLWEKPEEFRPSRFI 444
            :..|.|:.|.....|.........|:|:.||.||..:|:.....::..||..|..||||.|.||.
plant   292 KLVIKETFRLHPPGPFLLPRQVMSDIEIQGYHIPKNAHIKISTYAIGRDPKCWTNPEEFNPERFA 356

  Fly   445 DTEGKVRKPEY-FIPFGVGRRMCLGDVLARMELFLFFASFMHCFDIALPEGQPLPSLKGNVGATI 508
            :|....:...| .:|||.|||.|.|..|....|.|...:.::.||.:||.|..:..:.......:
plant   357 NTSINYKGQHYELLPFGAGRRSCPGMTLGITILELGLLNILYYFDWSLPNGMTIKDIDMEEDGAL 421

  Fly   509 TPESFKVCLKRRPLGPTA 526
            |... ||.|:..|..|.:
plant   422 TIAK-KVPLELIPTLPAS 438

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cyp18a1NP_523403.2 p450 54..517 CDD:278495 92/397 (23%)
CYP71B8NP_680342.2 p450 3..434 CDD:299894 93/402 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100036
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X6
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.900

Return to query results.
Submit another query.