DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cyp18a1 and CYP71B13

DIOPT Version :9

Sequence 1:NP_523403.2 Gene:Cyp18a1 / 32858 FlyBaseID:FBgn0010383 Length:538 Species:Drosophila melanogaster
Sequence 2:NP_197896.1 Gene:CYP71B13 / 832585 AraportID:AT5G25140 Length:496 Species:Arabidopsis thaliana


Alignment Length:524 Identity:132/524 - (25%)
Similarity:243/524 - (46%) Gaps:68/524 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    25 HLLMVFLGLLALVTLLQWLVRNYRELRK-LPPGPWGLPVIGYLLFMGSEKHTRFMELAKQYGSLF 88
            ::::||:...::     ::.:|.|:.:| |||||..||:||.|..:||:.|....:|:::||.|.
plant     5 YIIVVFVFFASI-----FIAKNTRKTKKNLPPGPPRLPIIGNLHQLGSKPHRSMFKLSEKYGPLV 64

  Fly    89 STRLGSQLTVVMSDYKMI--------RECFRREEFT-------GRPDTPFMQTLNGYGIINSTGK 138
            ..:||...:||.|..:.:        ::|..|...|       ...|..|.          ...|
plant    65 YLKLGKVPSVVASTPETVKDVLKTFDKDCCSRAFLTYPARISYNLKDLAFA----------PYSK 119

  Fly   139 LWKDQRR------FLHDKLRQFGMTYMGNGKQQMQKRIMTEVHEFIGHLHASDGQPVDMSPVISV 197
            .||..|:      :...:::.|         :.:::..:....|||.| .||..:.|:::..:..
plant   120 YWKAVRKMTVVELYTAKRVKSF---------RNIREEEVASFVEFIKH-SASLEEIVNLNQTLVK 174

  Fly   198 AVSNVICSLMMSTRFSIDDPKFRR-FNFLIEEGMRLFGEIHTVDYIPTM-QCFPSISTAKNKIAQ 260
            ...:|||.:...  .:::..|... :..:|...|.:.|.....||.|.: .....|:...||..:
plant   175 LSGSVICRVGFG--INLEGSKLENTYEEVIHGTMEVLGSFAASDYFPVIGGIIDRITGLHNKCEK 237

  Fly   261 NRAEMQRFYQDVIDDHKRSFDPNNIRDLVDFYLCEIEKAKAEGTDAELFDGKNHEEQLVQVIIDL 325
            .......|:...|..|..  |..:..|:||. |.::|:.:. |.....|. :||.:   .:::|:
plant   238 VFKGTDSFFDHCIKHHLE--DGGSKDDIVDL-LLKVERGEI-GLGEFQFT-RNHTK---GILLDI 294

  Fly   326 FSAGMETIKTTLLWINVFMLRNPKEMRRVQDELDQVVGRHRLPTIEDLQYLPITESTILESMRRS 390
            ..||::|...|:.|:...:::||:.|::.|.|:.:|:......|.||::.|...:..:.|::|.:
plant   295 LLAGVDTSGHTITWVMTHLIKNPRVMKKAQAEVREVIKNKDNITEEDIEGLEYLKMVVKETLRIN 359

  Fly   391 SIVPLATTHSPTRDVELNGYTIPAGSHVIPLINSVHMDPNLWEKPEEFRPSRFIDTEGKVRKPEY 455
            .:|||.|....::||::.||.||..:.:...|.::|.:||:|:.||.|.|.||:|.:...:...:
plant   360 PLVPLLTPREASKDVKIGGYNIPKKTWIHVNIWAIHRNPNVWKDPEAFIPERFMDNQIDYKGLNF 424

  Fly   456 -FIPFGVGRRMCLGDVLARMELFLFFASFMHCFDIALPEGQPLPSLKGNVGATITPESF-KVCLK 518
             .:|||.|||:|.|..:....:.|...:.::.||..||||..:..:.       ..||: .||.|
plant   425 ELLPFGSGRRICPGIGMGMALIHLTLINLLYRFDWKLPEGMEVEDVD-------LEESYGLVCPK 482

  Fly   519 RRPL 522
            :.||
plant   483 KVPL 486

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cyp18a1NP_523403.2 p450 54..517 CDD:278495 122/487 (25%)
CYP71B13NP_197896.1 p450 1..490 CDD:299894 132/524 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X6
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.000

Return to query results.
Submit another query.