DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cyp18a1 and CYP71B11

DIOPT Version :9

Sequence 1:NP_523403.2 Gene:Cyp18a1 / 32858 FlyBaseID:FBgn0010383 Length:538 Species:Drosophila melanogaster
Sequence 2:NP_197894.1 Gene:CYP71B11 / 832583 AraportID:AT5G25120 Length:496 Species:Arabidopsis thaliana


Alignment Length:512 Identity:134/512 - (26%)
Similarity:242/512 - (47%) Gaps:44/512 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    25 HLLMVFLGLLALVTLLQWLVRNYRELRK-LPPGPWGLPVIGYLLFMGSEKHTRFMELAKQYGSLF 88
            ::::.|:....::     :|||.|:.:| |||||..||:||.|..:||:.|:...:|:::||.|.
plant     5 YIIVAFVFFSTII-----IVRNTRKTKKNLPPGPPRLPIIGNLHQLGSKPHSSMFKLSEKYGPLM 64

  Fly    89 STRLGSQLTVVMSDYKMIRECFRR--EEFTGRPDTPF----MQTLNGYGIINSTGKLWKDQRRFL 147
            :.|.||..|||.|..:.::|..:.  .|...||...:    ...|...|....| |.|::.|:..
plant    65 ALRFGSVSTVVASTPETVKEVLKTFDAECCSRPYMTYPARLTYNLKDIGFCPYT-KYWREVRKMT 128

  Fly   148 HDKLRQFGMTYMGNGKQQMQKRIMTEVHEFIGHL--HASDGQPVDMSPVISVAVSNVICSLMMST 210
            ..:|      |.....|..|.....||...:..:  .||..:||:::..:.....:|||.::.. 
plant   129 VVEL------YTAKRVQSFQHTRKEEVASLVDFITQAASLEKPVNLNTKLMKLSGSVICRVVFG- 186

  Fly   211 RFSIDDPKFRR-FNFLIEEGMRLFGEIHTVDYIPTM-QCFPSISTAKNKIAQNRAEMQRFYQDVI 273
             .::...|... :..:|:..|.:.|.....||.|.: :....|:...:|..:....|..|:...|
plant   187 -INLKGSKLENLYEEVIQGTMEVVGSFAAADYFPIIGRIIDRITGLHSKCEKIFKAMDAFFDQSI 250

  Fly   274 DDHKRSFDPNNIR-DLVDFYLCEIEKAKAEGTDAELFDGKNHEEQLVQVIIDLFSAGMETIKTTL 337
            ..|   .:..:|: |::|..|      |.|..:.||.:.:...:....::.::.:||::|....:
plant   251 KHH---LEDESIKDDIIDLLL------KMERGEIELGEFQLTRDNTKGILFNILNAGIDTSAQVM 306

  Fly   338 LWINVFMLRNPKEMRRVQDELDQVVGRHRLPTIEDLQYLPITESTILESMRRSSIVPLATTHSPT 402
            .|:..:::.||:.|::.|.|:.:|:........||::.|...:..:.|:.|...:|||......:
plant   307 TWVMTYLISNPRVMKKAQAEVREVIKNKDDIIEEDIERLEYLKMVVKETFRVLPLVPLLIPREAS 371

  Fly   403 RDVELNGYTIPAGSHVIPLINSVHMDPNLWEKPEEFRPSRFIDTEGKVRKPEY-FIPFGVGRRMC 466
            :||::.||.||..:.:...|.::|.:||:|:.||.|.|.||:|.:...:...: |:|||.|||||
plant   372 KDVKIGGYDIPKKTWIHVNIWAIHRNPNVWKDPEAFIPERFMDNQIDYKGLNFEFLPFGSGRRMC 436

  Fly   467 LGDVLARMELFLFFASFMHCFDIALPEGQPLPSLKGNVGATITPESF-KVCLKRRPL 522
            .|..:....:.|...:.::.||..||||..:..:.       ..||: .||.|:.||
plant   437 PGIGMGMALVHLTLINLLYRFDWKLPEGMEVEDVD-------LEESYGLVCPKKVPL 486

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cyp18a1NP_523403.2 p450 54..517 CDD:278495 123/475 (26%)
CYP71B11NP_197894.1 CYP71-like 59..486 CDD:410695 112/451 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X6
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.