DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cyp18a1 and CYP81D2

DIOPT Version :9

Sequence 1:NP_523403.2 Gene:Cyp18a1 / 32858 FlyBaseID:FBgn0010383 Length:538 Species:Drosophila melanogaster
Sequence 2:NP_195452.1 Gene:CYP81D2 / 829890 AraportID:AT4G37360 Length:499 Species:Arabidopsis thaliana


Alignment Length:530 Identity:143/530 - (26%)
Similarity:250/530 - (47%) Gaps:78/530 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    26 LLMVFLGLLALVTLLQWLVRNYRELRKLPPGP-WGLPVIGYLLFMGSEKHTRFMELAKQYGS--L 87
            |:::|.....:::|:..:.|..|:| .|||.| |.|||||:|..:....|..|:.:::..|.  :
plant     4 LMLIFTFCFIVLSLIFLIGRIKRKL-NLPPSPAWALPVIGHLRLLKPPLHRVFLSVSQSLGDAPI 67

  Fly    88 FSTRLGSQLTVVMSDYKMIRECFRREE--FTGRPDTPFMQTLNGYGIINST------GKLWKDQR 144
            .|.|||::|..|:|.:.:..|||.:.:  ...|..|...:.:: ||  |||      .:.|::.|
plant    68 ISLRLGNRLLFVVSSHSIAEECFTKNDVILANRQTTISTKHIS-YG--NSTVVSASYSEHWRNLR 129

  Fly   145 R------FLHDKLRQFGMTYMGNGKQQMQKRIMTEVHEFIGHL--HASDG-QPVDMSPVISVAVS 200
            |      |...:|..|...          :|  .|:...||.|  ::|.| ..|:|..:.|....
plant   130 RIGALEIFSAHRLNSFSSI----------RR--DEIRRLIGRLLRNSSYGFTKVEMKSMFSDLTF 182

  Fly   201 NVICSLMMSTRF----SIDDPKFRRFNFLIEEGMRLFGEIHTVDYIPTMQCFPSISTAKNKIAQN 261
            |.|..::....:    ..|||:.:|...||.|.|...|..:..||||.:..   |:.::.:|.:.
plant   183 NNIIRMLAGKCYYGDGKEDDPEAKRVRTLIAEAMSSSGPGNAADYIPILTW---ITYSETRIKKL 244

  Fly   262 RAEMQRFYQDVIDDHKRSFDPNNIRDLVDFYLCEIEKAKAEGTDAELFDGKNHEEQLVQVIIDLF 326
            ...:..|.|.::|: ||.........:||..|| :::.:.|.....:..|         .::.|.
plant   245 AGRLDEFLQGLVDE-KREGKEKKENTMVDHLLC-LQETQPEYYMDRIIKG---------TMLSLI 298

  Fly   327 SAGMETIKTTLLWINVFMLRNPKEMRRVQDELDQVVGRHRLPTIEDLQYLPITESTILESMRRSS 391
            :.|.:|...||.|....:|.||:.:.:.:||:|:::|..||....|:..||..::.:.|::|...
plant   299 AGGTDTTAVTLEWALSSLLNNPEVLNKARDEIDRMIGVDRLLEESDIPNLPYLQNIVSETLRLYP 363

  Fly   392 IVPLATTHSPTRDVELNGYTIPAGSHVIPLINSVHMDPNLWEKPEEFRPSRFIDTEGKVRKPEYF 456
            ..|:...|..::|.::.||.:|.|:.::....::|.||.||:.|..|:|.|| :.||:.:|   .
plant   364 AAPMLLPHVASKDCKVGGYDMPRGTMLLTNAWAIHRDPLLWDDPTSFKPERF-EKEGEAKK---L 424

  Fly   457 IPFGVGRRMCLGDVLARMELFLFFASFMHCFD----------------IALPEGQPLPSL---KG 502
            :|||:|||.|.|..||:..:.|...|.:.||:                :.:|:.:||.::   :.
plant   425 MPFGLGRRACPGSGLAQRLVTLSLGSLIQCFEWERIGEEEVDMTEGPGLTMPKARPLEAMCRARD 489

  Fly   503 NVGATITPES 512
            .|| .|.|:|
plant   490 FVG-KILPDS 498

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cyp18a1NP_523403.2 p450 54..517 CDD:278495 136/502 (27%)
CYP81D2NP_195452.1 p450 5..488 CDD:299894 137/516 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X6
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.000

Return to query results.
Submit another query.