DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cyp18a1 and FAH1

DIOPT Version :9

Sequence 1:NP_523403.2 Gene:Cyp18a1 / 32858 FlyBaseID:FBgn0010383 Length:538 Species:Drosophila melanogaster
Sequence 2:NP_195345.1 Gene:FAH1 / 829779 AraportID:AT4G36220 Length:520 Species:Arabidopsis thaliana


Alignment Length:496 Identity:132/496 - (26%)
Similarity:223/496 - (44%) Gaps:47/496 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    33 LLALVTLLQWLVRNYRELRKLPPGPWGLPVIGYLLFMGSEKHTRFMELAKQYGSLFSTRLGSQLT 97
            :::|...:.::.|..|.  ..||||.|.|:||.:|.|....|.....|||:||.|...|:|....
plant    22 VVSLFIFISFITRRRRP--PYPPGPRGWPIIGNMLMMDQLTHRGLANLAKKYGGLCHLRMGFLHM 84

  Fly    98 VVMSDYKMIRECFRREE--FTGRPDTPFMQTLNGYGIINST----GKLWKDQRRFLHDKLRQFGM 156
            ..:|..::.|:..:.::  |:.||.|..:..|. |...:..    |..|:..|:..       .|
plant    85 YAVSSPEVARQVLQVQDSVFSNRPATIAISYLT-YDRADMAFAHYGPFWRQMRKVC-------VM 141

  Fly   157 TYMGNGKQQMQKRIMTEVHEFIGHLHASDGQPVDMSPVISVAVSNVICSLMMSTRFSIDDPKFRR 221
            ......:.:....:..||.:.:..:..:.|:|:::...|.....|:.......:.......:|.|
plant   142 KVFSRKRAESWASVRDEVDKMVRSVSCNVGKPINVGEQIFALTRNITYRAAFGSACEKGQDEFIR 206

  Fly   222 FNFLIEEGMRLFGEIHTVDYIPTMQCFPSISTAKNKIAQNRAEMQRFYQDVIDDHKRS------- 279
               :::|..:|||..:..|:||...........| ::.:.|.::..|..|:||:|.:.       
plant   207 ---ILQEFSKLFGAFNVADFIPYFGWIDPQGINK-RLVKARNDLDGFIDDIIDEHMKKKENQNAV 267

  Fly   280 -----FDPNNIRDLVDFYLCEIEKAKAEGTDAELFDG-KNHEEQLVQVIIDLFSAGMETIKTTLL 338
                 .|.:.:.||:.||   .|:||.....|:|.:. |...:.:..:|:|:...|.||:.:.:.
plant   268 DDGDVVDTDMVDDLLAFY---SEEAKLVSETADLQNSIKLTRDNIKAIIMDVMFGGTETVASAIE 329

  Fly   339 WINVFMLRNPKEMRRVQDELDQVVGRHRLPTIEDLQYLPITESTILESMRRSSIVPLATTHSPTR 403
            |....:||:|::::|||.||.:|||..|.....|::.|...:.|:.|::|....:|| ..|....
plant   330 WALTELLRSPEDLKRVQQELAEVVGLDRRVEESDIEKLTYLKCTLKETLRMHPPIPL-LLHETAE 393

  Fly   404 DVELNGYTIPAGSHVIPLINSVHMDPNLWEKPEEFRPSRFIDTEGKVRKPEY------FIPFGVG 462
            |..::|:.||..|.|:....::..||..|..|:.||||||::.    ..|::      |||||.|
plant   394 DTSIDGFFIPKKSRVMINAFAIGRDPTSWTDPDTFRPSRFLEP----GVPDFKGSNFEFIPFGSG 454

  Fly   463 RRMCLGDVLARMELFLFFASFMHCFDIALPEGQPLPSLKGN 503
            ||.|.|..|....|.|..|..:|||...||:|.....|..|
plant   455 RRSCPGMQLGLYALDLAVAHILHCFTWKLPDGMKPSELDMN 495

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cyp18a1NP_523403.2 p450 54..517 CDD:278495 129/475 (27%)
FAH1NP_195345.1 PLN02183 1..520 CDD:165828 132/496 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 186 1.000 Domainoid score I986
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H77704
Inparanoid 1 1.050 192 1.000 Inparanoid score I1368
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X6
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
66.050

Return to query results.
Submit another query.