DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cyp18a1 and CYP83A1

DIOPT Version :9

Sequence 1:NP_523403.2 Gene:Cyp18a1 / 32858 FlyBaseID:FBgn0010383 Length:538 Species:Drosophila melanogaster
Sequence 2:NP_193113.1 Gene:CYP83A1 / 827011 AraportID:AT4G13770 Length:502 Species:Arabidopsis thaliana


Alignment Length:498 Identity:129/498 - (25%)
Similarity:242/498 - (48%) Gaps:63/498 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    29 VFLGLLAL-VTLLQWLVRNYRELR-KLPPGPWGLPVIGYLLFMGSEKHTRFME-LAKQYGSLFST 90
            :.:|::|| ..||.:|.:..:..| ||||||..|||||.||.:......||.. .||:||.:.|.
plant     4 IIIGVVALAAVLLFFLYQKPKTKRYKLPPGPSPLPVIGNLLQLQKLNPQRFFAGWAKKYGPILSY 68

  Fly    91 RLGSQLTVVMSDYKMIRECFRREE--FTGRPDTPFMQTLNGYGIINSTGKLWKDQRRFL------ 147
            |:||:..||:|..::.:|..:.::  |..||.....:.:: ||            ||.:      
plant    69 RIGSRTMVVISSAELAKELLKTQDVNFADRPPHRGHEFIS-YG------------RRDMALNHYT 120

  Fly   148 --HDKLRQFGMTYM---------GNGKQQMQKRIMTEVHEFIGHLHASDGQPVDMSPVISVAVSN 201
              :.::|:.||.::         .:.:::..:|:|.::::     .|...:.||:|.::....::
plant   121 PYYREIRKMGMNHLFSPTRVATFKHVREEEARRMMDKINK-----AADKSEVVDISELMLTFTNS 180

  Fly   202 VICSLMMSTRFSIDDPKFRRFNFLIEEGMRLFGEIHTVDYIPTMQCFPSIS--TAKNKIAQNRAE 264
            |:|......:::.|..:.:||..::.....:.|:|...|:.|.......:|  ||..|....|.:
plant   181 VVCRQAFGKKYNEDGEEMKRFIKILYGTQSVLGKIFFSDFFPYCGFLDDLSGLTAYMKECFERQD 245

  Fly   265 MQRFYQDVIDDHKRSFDPNNIR----DLVDFYLCEIEKAKAEGTDAELFDGKNHEEQLVQVIIDL 325
              .:.|:|:::   :.||..::    .::|. |..|.|.:.       |..:...:.:..||:|:
plant   246 --TYIQEVVNE---TLDPKRVKPETESMIDL-LMGIYKEQP-------FASEFTVDNVKAVILDI 297

  Fly   326 FSAGMETIKTTLLWINVFMLRNPKEMRRVQDELDQVVGR--HRLPTIEDLQYLPITESTILESMR 388
            ..||.:|....::|...::::.|:.:::.|.|:.:.:..  ....|.:|::.||...:.:.|::|
plant   298 VVAGTDTAAAAVVWGMTYLMKYPQVLKKAQAEVREYMKEKGSTFVTEDDVKNLPYFRALVKETLR 362

  Fly   389 RSSIVPLATTHSPTRDVELNGYTIPAGSHVIPLINSVHMDPNLW-EKPEEFRPSRFIDTEGKVRK 452
            ...::||....:..:|.::.||.||||:.|.....:|..|...| ..|:||||.||::.|...:.
plant   363 IEPVIPLLIPRACIQDTKIAGYDIPAGTTVNVNAWAVSRDEKEWGPNPDEFRPERFLEKEVDFKG 427

  Fly   453 PEY-FIPFGVGRRMCLGDVLARMELFLFFASFMHCFDIALPEG 494
            .:| |||||.|||||.|..|....|.:.:|:.:..|:..||.|
plant   428 TDYEFIPFGSGRRMCPGMRLGAAMLEVPYANLLLSFNFKLPNG 470

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cyp18a1NP_523403.2 p450 54..517 CDD:278495 120/471 (25%)
CYP83A1NP_193113.1 PLN02966 1..502 CDD:178550 129/498 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100036
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X6
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.810

Return to query results.
Submit another query.