DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cyp18a1 and CYP71A22

DIOPT Version :9

Sequence 1:NP_523403.2 Gene:Cyp18a1 / 32858 FlyBaseID:FBgn0010383 Length:538 Species:Drosophila melanogaster
Sequence 2:NP_680110.1 Gene:CYP71A22 / 823989 AraportID:AT3G48310 Length:490 Species:Arabidopsis thaliana


Alignment Length:488 Identity:118/488 - (24%)
Similarity:220/488 - (45%) Gaps:57/488 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    28 MVFLGLLALVTLLQWLVRNYRELRKLPPGPWGLPVIGYLLFMGSEKHTRFMELAKQYGSLFSTRL 92
            ::.|.|:..:|:|.::.:...:....|..|..||:||.|..:|...|.....|:.:||.|...|.
plant     7 IILLSLIIFITILFFIKQKKGKKSNTPASPPRLPLIGNLHQLGRHPHRSLCSLSNRYGPLMLLRF 71

  Fly    93 GSQLTVVMSDYKMIRECFRREE--FTGRPDTPFMQ---------TLNGYGIINSTGKLWKDQR-- 144
            |....:|:|...:.|:..:..:  |..||.:...:         .|..|      |:.|:..:  
plant    72 GLVPVLVVSSADVARDILKTYDRVFASRPRSKIFEKIFYEARDVALAPY------GEYWRQMKSV 130

  Fly   145 ---RFLHDKL-RQFGMTYMGNGKQQMQKRIMTEVHEFIGHLHASDGQPVDMSPVISVAVSNVICS 205
               ..|.:|: |.|     .|.:|:       |:...:..:..|....|::|.::....::||..
plant   131 CVLHLLTNKMVRSF-----RNVRQE-------EISLMMEKIQKSSSLQVNLSELLGSLTNDVISR 183

  Fly   206 LMMSTRFSIDDPKFRRFNFLIEEGMRLFGEIHTVDYIPTMQCFPSISTAKNKIAQNRAEMQRFYQ 270
            :.:..::| |:..|:.   |::...:|.||.....|:|.:.....||....::.:...::..|.:
plant   184 VALGRKYS-DETDFKE---LMKRLTKLLGEFCVGTYVPWLAWIDWISGLDGQLKKTGNDLDEFLE 244

  Fly   271 DVIDDHKRSFDPNNIR-DLVDFYLCEIEKAKAEGTDAELFDGKNHEEQLVQVIIDLFSAGMETIK 334
            .|:.||:   |.:..| |.|| .|..|::.|:.|.:.:....|       .:|:|:...|.:|..
plant   245 KVVQDHE---DGDAQRTDFVD-VLLRIQREKSVGFEIDRLSIK-------AIILDVVVGGTDTSY 298

  Fly   335 TTLLWINVFMLRNPKEMRRVQDELDQVVGRHRLPTIEDLQYLPITESTILESMRRSSIVPLATTH 399
            ..:.|....:|..|:.:.|:|:|:..:...:...:.:|::.:...::.|.|:||....:||...|
plant   299 ALMEWAMTELLHRPECLNRLQEEVRTICKGNSSVSEDDIKDMNYLKAVIKETMRLHPPLPLMVPH 363

  Fly   400 SPTRDVELNGYTIPAGSHVIPLIN--SVHMDPNLW-EKPEEFRPSRFIDTEGKVRKPEY-FIPFG 460
            ..|:||.|..|.||||:.|  :||  ::..:...| ...|:|||.|.:::....|...: .||||
plant   364 ESTQDVRLGDYHIPAGTQV--MINAWAIGREAATWGPDAEKFRPERHLNSSVDFRGHNFELIPFG 426

  Fly   461 VGRRMCLGDVLARMELFLFFASFMHCFDIALPE 493
            .|||:|.....|.:.:.:..|:.:|.:|..|||
plant   427 AGRRICPAISFAVILIEVTLANLVHRYDWRLPE 459

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cyp18a1NP_523403.2 p450 54..517 CDD:278495 114/462 (25%)
CYP71A22NP_680110.1 p450 24..482 CDD:299894 114/471 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X6
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.000

Return to query results.
Submit another query.