DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cyp18a1 and CYP71B38

DIOPT Version :9

Sequence 1:NP_523403.2 Gene:Cyp18a1 / 32858 FlyBaseID:FBgn0010383 Length:538 Species:Drosophila melanogaster
Sequence 2:NP_190011.1 Gene:CYP71B38 / 823550 AraportID:AT3G44250 Length:499 Species:Arabidopsis thaliana


Alignment Length:496 Identity:133/496 - (26%)
Similarity:227/496 - (45%) Gaps:45/496 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    26 LLMVFLGLLALVTLLQWLVRNYREL----RKLPPGPWGLPVIGYLLFMGSEKHTRFMELAKQYGS 86
            :.:.||.||.|..:|      :::|    .||||||.|||:||.|..:|...:..|.:::::||.
plant     3 IFLCFLLLLPLSLIL------FKKLLPSKGKLPPGPIGLPIIGNLHQLGKLLYKSFHKISQEYGP 61

  Fly    87 LFSTRLGSQLTVVMSDYKMIRECFRRE--EFTGRPDTP----FMQTLNGYGIINSTGKLWKDQRR 145
            :...|||....:|:|..:...|..:..  |...||.|.    |.......|.. ..|..|::.|:
plant    62 VVLLRLGVVPVIVVSSKEGAEEVLKTHDLETCTRPKTAATGLFTYNFKDIGFA-PFGDDWREMRK 125

  Fly   146 ------FLHDKLRQFGMTYMGNGKQQ-MQKRIMTEVHEFIGHLHASDGQPVDMSPVISVAVSNVI 203
                  |...||:.|  .|:...:.: :.|:|...|.|       :....||:..|:....:::|
plant   126 ITTLELFSVKKLKSF--RYIREEESELLVKKISKSVDE-------TQNSSVDLRKVLFSFTASII 181

  Fly   204 CSLMMSTRFSIDDPKFRRFNFLIEEGMRLFGEIHTVDYIPTMQCFPSISTAKNKIAQNRAEMQRF 268
            |.|.....|...|........|:.|.....|.....|:.|.......||...:::.:...::..|
plant   182 CRLAFGQNFHQCDFVDASLEELVLESEANLGTFAFADFFPGGWLIDRISGQHSRVNKAFYKLTNF 246

  Fly   269 YQDVIDDHKRSFDPNNIRDLVDFYLCEIEKAKAEGTDAELFDGKNHEEQLVQVIIDLFSAGMETI 333
            |:.|||||.::..|.:..|:|...|..|.|.    |.|:.|  |...:.|..|:.|:|.||:...
plant   247 YKHVIDDHLKTGQPQDHSDIVSVMLDMINKP----TKADSF--KVTYDHLKGVMSDIFLAGVNGG 305

  Fly   334 KTTLLWINVFMLRNPKEMRRVQDELDQVVG--RHRLPTIEDLQYLPITESTILESMRRSSIVPLA 396
            ..|::|....:.|:|:.|:::|:|:..::|  :.|: |.|||:.:...:..::|:.|.....||.
plant   306 ANTMIWTLTELSRHPRVMKKLQEEIRAMLGPNKERI-TEEDLEKVEYLKLVMVETFRLHPPAPLL 369

  Fly   397 TTHSPTRDVELNGYTIPAGSHVIPLINSVHMDPNLWEKPEEFRPSRFIDTEGKVRKPEYF--IPF 459
            .......|:::.||.||..:.:.....::..||..|::|.||.|.||:|:.... |.::|  :||
plant   370 LPRLTMSDIKIQGYNIPKNTMIQINTYAIGRDPKYWKQPGEFIPERFLDSPIDY-KGQHFELLPF 433

  Fly   460 GVGRRMCLGDVLARMELFLFFASFMHCFDIALPEGQPLPSL 500
            |.|||:|.|.......:.|...:.::.||.:||.|..:..:
plant   434 GAGRRICPGMATGITMVELGLLNLLYFFDWSLPNGMTIEDI 474

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cyp18a1NP_523403.2 p450 54..517 CDD:278495 124/464 (27%)
CYP71B38NP_190011.1 p450 27..497 CDD:386267 126/466 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100036
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X6
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.900

Return to query results.
Submit another query.