DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cyp18a1 and CYP71B25

DIOPT Version :9

Sequence 1:NP_523403.2 Gene:Cyp18a1 / 32858 FlyBaseID:FBgn0010383 Length:538 Species:Drosophila melanogaster
Sequence 2:NP_189258.1 Gene:CYP71B25 / 822230 AraportID:AT3G26270 Length:501 Species:Arabidopsis thaliana


Alignment Length:527 Identity:137/527 - (25%)
Similarity:237/527 - (44%) Gaps:61/527 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    26 LLMVFLGLLALVTL--LQWLVRNYRELRKLPPGPWGLPVIGYLLFMGSEKHTRFMELAKQYGSLF 88
            :|..||.||:|..|  |.:..:.....|.|||||..||::|.|..:....|....||:|::|.:.
plant     3 ILQSFLLLLSLPFLFTLIYTKKMKESKRNLPPGPAKLPIVGNLHQLQGMVHRCLHELSKKHGPVM 67

  Fly    89 STRLGSQLTVVMSDYKMIRECFRRE--EFTGRPDTPFMQTLN------GYGIINSTGKLWKDQRR 145
            ..:||....|::|..:...|..:..  |...||:|...:..:      |.|..:..   |::.|:
plant    68 HLQLGFVPLVLISSSEAAEEALKTHDIECCTRPNTNAARVFSRNNKNIGLGAYSDE---WRELRK 129

  Fly   146 ------FLHDKLRQFGMTYMGNGKQQMQKRIMTEVHEFIGHLHASDGQPVDMSPVISVAVSNVIC 204
                  |...|::.|  .|:...:..:..:.:.::        |....|||:|..:....::.:.
plant   130 VAVREYFSVKKVQSF--RYVREEENHLMVKKLRDL--------ALKQSPVDLSKTLFCLAASTVF 184

  Fly   205 SLMMSTRFS----IDDPKFRRFNFLIEEGMRL-FGEIHTVDYIPTMQCFPSISTAKNK-IAQNRA 263
            ..:....||    ..:.|.....|..::.:.. |.::..   ||.:..|....:.::| :.:...
plant   185 RPVFGQSFSDNKHFSEEKIEELVFEAQKSLTFKFSDLFP---IPGLGWFIGFVSGQHKGLHKVFI 246

  Fly   264 EMQRFYQDVIDDHKRSFDPNNIRDLVDFYLCEIEKAKAEGTDAELFDGKNHEEQLVQVIIDLFSA 328
            |:..|...:||||::...|.:..|:|...|..|...:.:.:.....|   |.:.:.|   |:|.|
plant   247 EVDNFLNHMIDDHQKQNQPQDRSDIVGSLLDMIHNQEQDKSFKLTID---HLKGITQ---DIFLA 305

  Fly   329 GMETIKTTLLWINVFMLRNPKEMRRVQDELDQVVG--RHRLPTIED---LQYLPITESTILESMR 388
            |::|...|::|....::.||:.|::||||:...:|  :.|:.. ||   ||||.:   .|.|::|
plant   306 GIDTSAITMIWAMAELVNNPRVMKKVQDEIRSCIGIKKERIEE-EDVGKLQYLKL---VIKETLR 366

  Fly   389 RSSIVPLATTHSPTRDVELNGYTIPAGSHVIPLINSVHMDPNLWEKPEEFRPSRFIDTEGKVRKP 453
            .....||........|:::.||.||..:.::....|:..||..|:.||||.|.||||.....:..
plant   367 LHPAAPLLLPRETMADIKIQGYDIPRKTLLLVSAWSLGRDPKYWKNPEEFNPERFIDCPVDYKGH 431

  Fly   454 EY-FIPFGVGRRMCLG--DVLARMELFLFFASFMHCFDIALPEGQPLPSLKGNVGATITPESFKV 515
            .: |:|||.|||.|.|  ..:|.:||.|.  :.::.||..|||.....:::.:...||..   ||
plant   432 SFEFLPFGSGRRFCPGMASAIATIELTLL--NLLYFFDWKLPEEMKDMNMEESGDVTIVK---KV 491

  Fly   516 CLKRRPL 522
            .|:..|:
plant   492 PLELLPV 498

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cyp18a1NP_523403.2 p450 54..517 CDD:278495 125/490 (26%)
CYP71B25NP_189258.1 p450 26..497 CDD:299894 128/501 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100036
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X6
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.900

Return to query results.
Submit another query.