DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cyp18a1 and CYP71B24

DIOPT Version :9

Sequence 1:NP_523403.2 Gene:Cyp18a1 / 32858 FlyBaseID:FBgn0010383 Length:538 Species:Drosophila melanogaster
Sequence 2:NP_189254.1 Gene:CYP71B24 / 822224 AraportID:AT3G26230 Length:498 Species:Arabidopsis thaliana


Alignment Length:518 Identity:136/518 - (26%)
Similarity:221/518 - (42%) Gaps:101/518 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    26 LLMVFLGLLALVTLLQWLVRNYREL-RKLPPGPWGLPVIGYLLFMGSEKHTRFMELAKQYGSLFS 89
            :|:.|:.||:|:     :::..::. |.|||.|..|||||.|..:....|....:|:|::|.:..
plant     3 ILLYFIALLSLI-----IIKKIKDSNRNLPPSPLKLPVIGNLYQLRGLFHKCLHDLSKKHGPVLL 62

  Fly    90 TRLGSQLTVVMSDYKMIRECFRRE--EFTGRPDTPFMQTLNGYGIINSTGKLWKDQRRFLHDKLR 152
            .|||....||:|..:...|..:..  |...||            |.|.|.|||:|.        :
plant    63 LRLGFLDMVVISSTEAAEEALKVHDLECCTRP------------ITNVTSKLWRDG--------Q 107

  Fly   153 QFGMTYMGNGKQQMQKRIM------TEVHEF-----------IGHLH--ASDGQPVDMSPVISVA 198
            ..|:...|...::::|...      |:|..|           :..|.  |.....||:|..:...
plant   108 DIGLAPYGESLRELRKLSFLKFFSTTKVRSFRYIREEENDLMVKKLKEAALKKSSVDLSQTLFGL 172

  Fly   199 VSNVICSLMMSTRF---------SIDDPKFRRFNFLIEEGMRLFGEIHTVDYIPTMQCFPS---- 250
            |.::|.......||         .|:|..|               |:..:..:.....||.    
plant   173 VGSIIFRSAFGQRFDEGNHVNAEKIEDLMF---------------EVQKLGALSNSDLFPGGLGW 222

  Fly   251 ----ISTAKNKIAQNRAEMQRFYQDVIDDH-KRSFD--PNNIRDLVDFYLCEIEKAKAEGTDAEL 308
                :|....|:.:...|:......:|||| |.|.:  .::..|::|..|..|.| :.:|...:|
plant   223 FVDFVSGHNKKLHKVFVEVDTLLNHIIDDHLKNSIEEITHDRPDIIDSLLDMIRK-QEQGDSFKL 286

  Fly   309 FDGKNHEEQLVQVIIDLFSAGMETIKTTLLWINVFMLRNPKEMRRVQDELDQVVGRHRLPTIED- 372
                 ..:.|..:|.|::.||::|...|::|....:::||:.|::||||:...:|..:...||: 
plant   287 -----TIDNLKGIIQDIYLAGVDTSAITMIWAMAELVKNPRVMKKVQDEIRTCIGIKQNEKIEED 346

  Fly   373 ----LQYLPITESTILESMRRSSIVPLATTHSPTRDVELNGYTIPAGSHVIPLIN--SVHMDPNL 431
                ||||.:   .:.|::|.....||.........:::.||.||  |..|.|:|  |:..||..
plant   347 DVDKLQYLKL---VVKETLRLHPAAPLLLPRETMSQIKIQGYNIP--SKTILLVNVWSIGRDPKH 406

  Fly   432 WEKPEEFRPSRFIDTEGKVRKPEY-FIPFGVGRRMCLGDVLARMELFLFFASFMHCFDIALPE 493
            |:.||||.|.||||.....:...: .:|||.|||:|.|...|...:.|...:.::.||..|||
plant   407 WKNPEEFNPERFIDCPIDYKGNSFEMLPFGSGRRICPGIAFAIATVELGLLNLLYHFDWRLPE 469

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cyp18a1NP_523403.2 p450 54..517 CDD:278495 129/489 (26%)
CYP71B24NP_189254.1 p450 1..495 CDD:299894 136/518 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100036
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X6
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.900

Return to query results.
Submit another query.