DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cyp18a1 and CYP71B3

DIOPT Version :9

Sequence 1:NP_523403.2 Gene:Cyp18a1 / 32858 FlyBaseID:FBgn0010383 Length:538 Species:Drosophila melanogaster
Sequence 2:NP_189253.1 Gene:CYP71B3 / 822223 AraportID:AT3G26220 Length:501 Species:Arabidopsis thaliana


Alignment Length:543 Identity:141/543 - (25%)
Similarity:235/543 - (43%) Gaps:81/543 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    26 LLMVFLGLLALVTLLQWLVRNYRE-LRKLPPGPWGLPVIGYLLFMGSEKHTRFMELAKQYGSLFS 89
            :|:.|..|..:::|:  .::.::: .|.|||.|..||:||.|..:....|....:|:|::|.:..
plant     3 ILLYFFFLPVILSLI--FMKKFKDSKRNLPPSPPKLPIIGNLHQLRGLFHRCLHDLSKKHGPVLL 65

  Fly    90 TRLGSQLTVVMSDYKMIRECFRRE--EFTGRPDTPFMQTLNGYG---IINSTGKLWKDQRR---- 145
            .|||....||:|..:...|..:..  |...||.|......:..|   .....|::.::.|:    
plant    66 LRLGFIDMVVISSKEAAEEVLKVHDLECCTRPKTNASSKFSRDGKDIAFAPYGEVSRELRKLSLI 130

  Fly   146 --FLHDKLRQFGMTYMGNGKQQMQKRIMTEVHEFIGHLHASDGQPVDMSPVISVAVSNVICSLMM 208
              |...|:|.|  .|:...:..:..:.:.|        .|.....||:|..:...|.::|.....
plant   131 NFFSTQKVRSF--RYIREEENDLMVKKLKE--------SAKKKNTVDLSQTLFYLVGSIIFRATF 185

  Fly   209 STRFS----IDDPKFRRFNFLIEEGMRLFGEIHTVDYIPTMQCFPS--------ISTAKNKIAQN 261
            ..|..    ::..|       |||   |..|:..|..:.:...||:        :|.....:.:.
plant   186 GQRLDQNKHVNKEK-------IEE---LMFEVQKVGSLSSSDIFPAGVGWFMDFVSGRHKTLHKV 240

  Fly   262 RAEMQRFYQDVIDDH-KRSFDPNN--IRDLVDFYLCEIEKAKAEGTDAELFDGKNHEEQLVQVII 323
            ..|:......|||.| |...|..|  ..|::|..|..|.|.:.:    |.|  |...:.|..:|.
plant   241 FVEVDTLLNHVIDGHLKNPEDKTNQDRPDIIDSILETIYKQEQD----ESF--KLTIDHLKGIIQ 299

  Fly   324 DLFSAGMETIKTTLLWINVFMLRNPKEMRRVQDELDQVVGRHRLPTIED-----LQYLPITESTI 383
            :::.||::|...|::|....:::||:.|::.|:|:...:|..:...||:     ||||.:   .|
plant   300 NIYLAGVDTSAITMIWAMAELVKNPRVMKKAQEEIRTCIGIKQKERIEEEDVDKLQYLKL---VI 361

  Fly   384 LESMRRSSIVPLATTHSPTRDVELNGYTIPAGSHVIPLIN--SVHMDPNLWEKPEEFRPSRFIDT 446
            .|::|.....||........|:::.||.||  ...|.|:|  |:..:|.|||.||||.|.||||.
plant   362 KETLRLHPPAPLLLPRETMADIKIQGYDIP--RKTILLVNAWSIGRNPELWENPEEFNPERFIDC 424

  Fly   447 EGKVRKPEY-FIPFGVGRRMCLGDV--LARMELFLFFASFMHCFDIALPEGQPLPSLKGNVGATI 508
            ....:...: .:|||.||::|.|..  :|.:||.|.  :.::.||..|.|......::....|||
plant   425 PMDYKGNSFEMLPFGSGRKICPGIAFGIATVELGLL--NLLYYFDWRLAEEDKDIDMEEAGDATI 487

  Fly   509 TPESFKVCLKRRPLGPTAADPHH 531
            ..   ||.|:..|:      .||
plant   488 VK---KVPLELVPI------IHH 501

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cyp18a1NP_523403.2 p450 54..517 CDD:278495 131/498 (26%)
CYP71B3NP_189253.1 p450 1..500 CDD:386267 139/540 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100036
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X6
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.900

Return to query results.
Submit another query.