DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cyp18a1 and CYP71B22

DIOPT Version :9

Sequence 1:NP_523403.2 Gene:Cyp18a1 / 32858 FlyBaseID:FBgn0010383 Length:538 Species:Drosophila melanogaster
Sequence 2:NP_189251.1 Gene:CYP71B22 / 822221 AraportID:AT3G26200 Length:500 Species:Arabidopsis thaliana


Alignment Length:537 Identity:137/537 - (25%)
Similarity:226/537 - (42%) Gaps:77/537 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    28 MVFLGLLALVTLLQWLVRNYRELR----KLPPGPWGLPVIGYLLFMGSEKHTRFMELAKQYGSLF 88
            :.||.||.|..:.      :::|.    ||||||.|||:||.|..:|...|..|.:|::.||.:.
plant     5 LYFLLLLPLFLIF------FKKLSPSKGKLPPGPLGLPIIGNLHQLGKSLHRSFHKLSQNYGPVM 63

  Fly    89 STRLGSQLTVVMSDYKMIRECFRRE--EFTGRP-------------DTPFMQTLNGYGIINSTGK 138
            ....|....||:|..:...|..:..  |...||             |..|.|          .|.
plant    64 FLHFGVVPVVVVSTREAAEEVLKTHDLETCTRPKLTATKLFSYNYKDIGFAQ----------YGD 118

  Fly   139 LWKDQRR------FLHDKLRQFGMTYMGNGKQQMQKRIMTEVHEFIGHLHASDGQP---VDMSPV 194
            .|::.|:      |...||:.|             :.|..|..|.:.:..:...:.   ||:...
plant   119 DWREMRKLAMLELFSSKKLKAF-------------RYIREEESEVLVNKLSKSAETRTMVDLRKA 170

  Fly   195 ISVAVSNVICSLMMSTRF-SIDDPKFRRFNFLIEEGMRLFGEIHTVDYIPT--MQCFPSISTAKN 256
            :....::::|.|.....| ..|.....:...|:.|.....|.....|:.|.  ......||...:
plant   171 LFSYTASIVCRLAFGQNFHECDFVDMDKVEDLVLESETNLGSFAFTDFFPAGLGWVIDRISGQHS 235

  Fly   257 KIAQNRAEMQRFYQDVIDDHKRSFDPNNIRDLVDFYLCEIEKAKAEGTDAELFDGKNHEEQLVQV 321
            ::.:..|.:..|:|.|||||.:.....:..|::...|..|.|....|:....:|      .|..|
plant   236 ELHKAFARLSNFFQHVIDDHLKPGQSQDHSDIIGVMLDMINKESKVGSFQVTYD------HLKGV 294

  Fly   322 IIDLFSAGMETIKTTLLWINVFMLRNPKEMRRVQDELDQVVGRHRLP-TIEDLQYLPITESTILE 385
            :.|:|.||:.....|::|....:.|:|:.|:::|.|:.:::|.::.. |.:||:.:...:..|.|
plant   295 MSDVFLAGVNAGAITMIWAMTELARHPRVMKKLQQEIREILGDNKEKITEQDLEKVHYLKLVIEE 359

  Fly   386 SMRRSSIVPLATTHSPTRDVELNGYTIPAGSHVIPLINSVHMDPNLWEKPEEFRPSRFIDTEGKV 450
            :.|.....||........|:::.||.||..:.:.....|:..|||.||.|.:|.|.||||:..:.
plant   360 TFRLHPPAPLLLPRETMSDLKIQGYNIPKNTMIEINTYSIGRDPNCWENPNDFNPERFIDSPVEY 424

  Fly   451 RKPEY-FIPFGVGRRMCLGDVLARMELFLFFASFMHCFDIALPEGQPLPSL-KGNVGATITPESF 513
            :...| .:|||.|||:|.|.......:.|...:.::.||.:||:|..:..: ....||.:..:  
plant   425 KGQHYELLPFGAGRRICPGMATGITIVELGLLNVLYFFDWSLPDGMKIEDIDMEEAGAFVVAK-- 487

  Fly   514 KVCLKRRPLGPTAADPH 530
            ||.|:   |.||   ||
plant   488 KVPLE---LIPT---PH 498

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cyp18a1NP_523403.2 p450 54..517 CDD:278495 123/492 (25%)
CYP71B22NP_189251.1 CYP71-like 59..491 CDD:410695 109/462 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100036
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X6
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.900

Return to query results.
Submit another query.