DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cyp18a1 and CYP712A1

DIOPT Version :9

Sequence 1:NP_523403.2 Gene:Cyp18a1 / 32858 FlyBaseID:FBgn0010383 Length:538 Species:Drosophila melanogaster
Sequence 2:NP_181754.1 Gene:CYP712A1 / 818826 AraportID:AT2G42250 Length:514 Species:Arabidopsis thaliana


Alignment Length:513 Identity:121/513 - (23%)
Similarity:224/513 - (43%) Gaps:64/513 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    27 LMVFLGLLA----LVTLLQWLVRNYREL--RKLPPGPWGLPVIGYLLFMGSEKHTRFMELAKQYG 85
            |::.:..||    |..|.:|.::....|  .|||..|..||.||:|..:|......|..||.:||
plant     9 LIILITSLAFPFMLYALFKWFLKEQGSLAATKLPQSPPALPFIGHLHLIGKVLPVSFQSLAHKYG 73

  Fly    86 SLFSTRLGSQLTVVMSDYKMIRECFRREE--FTGRPD---TPFMQTLNGYGIINSTGKLWKDQRR 145
            .|...|||:...||:|...:.||.|:.:|  |:.||:   ..:.:......::...|..|:..::
plant    74 PLMEIRLGASKCVVVSSSSVAREIFKEQELNFSSRPEFGSAEYFKYRGSRFVLAQYGDYWRFMKK 138

  Fly   146 FLHDKLRQF-GMTYMGNGKQQMQKRIMTEVHEFIGHLHASDGQPVDMSPVISVAVSNVICSLMMS 209
            ....||... .:....:.:::.:.:::..|.:.     ..:|.|.|:|.......:||||.:.||
plant   139 LCMTKLLAVPQLEKFADIREEEKLKLVDSVAKC-----CREGLPCDLSSQFIKYTNNVICRMAMS 198

  Fly   210 TRFSIDDPKFRRFNFLIEEGMRLFGEIHTVDYIPTMQCFPSISTAKNKIAQNRAEMQRFYQDVID 274
            ||.|..|.:......|:::.:.|.|:|...|.:..::........|..:    |.|:::      
plant   199 TRCSGTDNEAEEIRELVKKSLELAGKISVGDVLGPLKVMDFSGNGKKLV----AVMEKY------ 253

  Fly   275 DHKRSFDPNNIRDLVDFYLCEIEKAKA---EGTDAELFD------------GKNHEEQLVQVIID 324
                        ||:...:.:..:|||   :||..::.|            .|.....:...::|
plant   254 ------------DLLVERIMKEREAKAKKKDGTRKDILDILLETYRDPTAEMKITRNDMKSFLLD 306

  Fly   325 LFSAGMETIKTTLLWINVFMLRNPKEMRRVQDELDQVVGRHRLPTIEDLQYLPITESTILESMRR 389
            :|.||.:|....:.|....::.:|:...::::|::.|||..||....|:..||...:.:.|::|.
plant   307 VFMAGTDTSAAAMQWAMGQLINHPQAFNKLREEINNVVGSKRLVKESDVPNLPYLRAVLRETLRL 371

  Fly   390 SSIVPLATTHSPTRDVELNGYTIPAGSHVIPLINSVHMDPNLWEKPEEFRPSRFID-TEGKVRKP 453
            ....||..... ..|.::||..:.:.:.|:..:.::..|..||...:.|.|.||:: :|.|:.:.
plant   372 HPSAPLIIREC-AEDCQVNGCLVKSKTRVLVNVYAIMRDSELWADADRFIPERFLESSEEKIGEH 435

  Fly   454 EY--------FIPFGVGRRMCLGDVLARMELFLFFASFMHCFDIALPEGQPLPSLKGN 503
            :.        ::|||.|||.|.|..||...:.:...|.:..||....:||.:...:|:
plant   436 QMQFKGQNFRYLPFGSGRRGCPGASLAMNVMHIGVGSLVQRFDWKSVDGQKVDLSQGS 493

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cyp18a1NP_523403.2 p450 54..517 CDD:278495 112/480 (23%)
CYP712A1NP_181754.1 p450 9..508 CDD:299894 121/513 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X6
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.000

Return to query results.
Submit another query.