DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cyp18a1 and Cyp2d22

DIOPT Version :9

Sequence 1:NP_523403.2 Gene:Cyp18a1 / 32858 FlyBaseID:FBgn0010383 Length:538 Species:Drosophila melanogaster
Sequence 2:NP_001156944.1 Gene:Cyp2d22 / 56448 MGIID:1929474 Length:500 Species:Mus musculus


Alignment Length:497 Identity:177/497 - (35%)
Similarity:257/497 - (51%) Gaps:34/497 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly    34 LALVTLLQWLVRNYRELRKLPPGPWGLPVIGYLLFMGSEK-HTRFMELAKQYGSLFSTRLGSQLT 97
            |.||.|:.|   ..|.....||||...||:|.||.|..:. ...|.:|..:||.|||.:|.|:..
Mouse    20 LILVNLMHW---RQRWTAHYPPGPMPWPVLGNLLHMDFQNMPAGFQKLRGRYGDLFSLQLASESV 81

  Fly    98 VVMSDYKMIRECF--RREEFTGRPDTPFMQTLNGYG------IINSTGKLWKDQRRFLHDKLRQF 154
            ||::....:||..  ..|:...||...|...| |:|      ::...|..|:.||||....:..|
Mouse    82 VVLNGLTALREALVKHSEDTADRPPLHFNDLL-GFGPRSQGIVLARYGPAWRQQRRFSVSTMHHF 145

  Fly   155 GMTYMGNGKQQMQKRIMTEVHEFIGHLHASDGQPVDMSPVISVAVSNVICSLMMSTRFSIDDPKF 219
            |:     ||:.:::.:..|............|.|...:.::..||.|||.||:.:.||..|||:|
Mouse   146 GL-----GKKSLEQWVTEEARCLCAAFADHTGHPFSPNTLLDKAVCNVIASLLYACRFEYDDPRF 205

  Fly   220 RRFNFLIEEGMRLFGEIHTVDYIPT-MQCFP---SISTAKNKIAQNRAEMQRFYQDVIDDHKRSF 280
            .|...|::|.::     ....::|. :..||   .|.....|:...:........:::.:||.::
Mouse   206 IRLLGLLKETLK-----EEAGFLPMFLNVFPMLLRIPGLVGKVFPGKRAFVTMLDELLAEHKTTW 265

  Fly   281 DPNN-IRDLVDFYLCEIEKAKAEGTDAELFDGKNHEEQLVQVIIDLFSAGMETIKTTLLWINVFM 344
            ||.. .|||.|.:|.|:||||  |.....|    ::|.|..|:.|||||||.|..|||.|..:.|
Mouse   266 DPTQPPRDLTDAFLAEVEKAK--GNPESSF----NDENLRTVVGDLFSAGMVTTSTTLSWALMLM 324

  Fly   345 LRNPKEMRRVQDELDQVVGRHRLPTIEDLQYLPITESTILESMRRSSIVPLATTHSPTRDVELNG 409
            :.:|...||||.|:|:|:|:.:.|.:.|...:|.|.:.|.|..|.:.|:||...|..:||:||.|
Mouse   325 ILHPDVQRRVQQEIDEVIGQVQCPEMADQARMPYTNAVIHEVQRFADILPLGVPHKTSRDIELQG 389

  Fly   410 YTIPAGSHVIPLINSVHMDPNLWEKPEEFRPSRFIDTEGKVRKPEYFIPFGVGRRMCLGDVLARM 474
            :.||.|:.:|..::|...|..:||||..|.|..|:|.:|...|||.|:||..|||.|||:.||||
Mouse   390 FLIPKGTTLITNLSSALKDETVWEKPLCFHPEHFLDAQGHFVKPEAFMPFSAGRRSCLGEPLARM 454

  Fly   475 ELFLFFASFMHCFDIALPEGQPLPSLKGNVGATITPESFKVC 516
            ||||||...:..|.|::|:|||.||..|...|..||..:::|
Mouse   455 ELFLFFTCLLQRFSISVPDGQPQPSDHGVFRALTTPCPYQLC 496

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cyp18a1NP_523403.2 p450 54..517 CDD:278495 171/477 (36%)
Cyp2d22NP_001156944.1 p450 37..496 CDD:278495 170/475 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 290 1.000 Domainoid score I1539
eggNOG 1 0.900 - - E33208_3BC78
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG45226
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - otm43796
orthoMCL 1 0.900 - - OOG6_100036
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R4520
SonicParanoid 1 1.000 - - X6
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
98.750

Return to query results.
Submit another query.