DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cyp18a1 and Cyp2j16

DIOPT Version :9

Sequence 1:NP_523403.2 Gene:Cyp18a1 / 32858 FlyBaseID:FBgn0010383 Length:538 Species:Drosophila melanogaster
Sequence 2:XP_578474.1 Gene:Cyp2j16 / 502969 RGDID:1561242 Length:503 Species:Rattus norvegicus


Alignment Length:493 Identity:160/493 - (32%)
Similarity:255/493 - (51%) Gaps:24/493 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly    33 LLALVTLLQWLVRNYRELRK---LPPGPWGLPVIGYLLFMG---SEKHTRFMELAKQYGSLFSTR 91
            ||.|:|.|  |:.:|.:.|:   .|||||.||.:|.|....   |..|.|..:..|:||:|.|..
  Rat    22 LLTLLTFL--LLADYLKNRRPNNYPPGPWRLPFVGNLFQFDLNISHLHLRIQQFVKKYGNLISLD 84

  Fly    92 LGSQLTVVMSDYKMIRECF--RREEFTGRPDTPF-MQTLNGYGIINSTGKLWKDQRRFLHDKLRQ 153
            .|:...||::...:|:|..  ..:.|..||..|. .:.....||..:....||:||||....|:.
  Rat    85 FGNISVVVITGLPLIKEALINNEQNFLKRPIVPSRYRVFKDNGIFFANVHKWKEQRRFALTMLKN 149

  Fly   154 FGMTYMGNGKQQMQKRIMTEVHEFIGHLHASDGQPVDMSPVISVAVSNVICSLMMSTRFSIDDPK 218
            ||:     ||:.:::.|..|.|..:..:....|||.|....|:.||||:|||:....||..||.:
  Rat   150 FGL-----GKKSLEQCIQEEAHHLVEVIGEEKGQPFDPHFRINNAVSNIICSITFGERFEYDDSQ 209

  Fly   219 FRRFNFLIEEGMRLFGEIHTVDYIPTMQCFPSISTAKNKIAQNRAEMQRFYQDVIDDHKRSFDPN 283
            |:....|.:|.:.....:.:|.|......|..:......:.:|..:::....::||.|::.::|:
  Rat   210 FQELLKLADEVICSEASMTSVLYNVFPLIFKYLPGPHQTVFKNWEKLKSIVANMIDRHRKDWNPD 274

  Fly   284 NIRDLVDFYLCEIEKAKAEGTDAELFDGKNHEEQLVQVIIDLFSAGMETIKTTLLWINVFMLRNP 348
            ..||.||.:|.|:.|...:.|.:      .:||.|:...:|||.||.||..|||.|..:::..||
  Rat   275 EPRDFVDAFLTEMTKYPDKTTTS------FNEENLIATTLDLFFAGTETTSTTLRWALLYITLNP 333

  Fly   349 KEMRRVQDELDQVVGRHRLPTIEDLQYLPITESTILESMRRSSIVPLATTHSPTRDVELNGYTIP 413
            :...:|..|:|:|:|..|||:.:|...:|.|.:.|.|.:|..:|:||......|.|..|.|:.:|
  Rat   334 EVQEKVHSEIDRVIGHGRLPSTDDQDAMPYTNAVIHEVLRMGNIIPLNVPREVTADSTLAGFHLP 398

  Fly   414 AGSHVIPLINSVHMDPNLWEKPEEFRPSRFIDTEGKVRKPEYFIPFGVGRRMCLGDVLARMELFL 478
            .|..::..:.::|.||..|..|:.|.|..|:: .|:.:|.:.|:||.||:|.|.|:.||:.|||:
  Rat   399 KGKMILTNLTALHRDPKEWATPDTFNPEHFLE-NGQFKKRDSFLPFSVGKRACPGEKLAKSELFI 462

  Fly   479 FFASFMHCFDIALPEGQPLPSLKGNVGATITPESFKVC 516
            ||.:.|..|....|..:.| |||...|.::.|.|:::|
  Rat   463 FFTALMQNFTFKAPTNEKL-SLKLRKGLSLYPVSYRIC 499

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cyp18a1NP_523403.2 p450 54..517 CDD:278495 152/469 (32%)
Cyp2j16XP_578474.1 p450 44..499 CDD:278495 151/467 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG45226
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000008
OrthoInspector 1 1.000 - - otm45879
orthoMCL 1 0.900 - - OOG6_100036
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X6
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
76.820

Return to query results.
Submit another query.