DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cyp18a1 and Cyp2c6v1

DIOPT Version :9

Sequence 1:NP_523403.2 Gene:Cyp18a1 / 32858 FlyBaseID:FBgn0010383 Length:538 Species:Drosophila melanogaster
Sequence 2:NP_001013926.2 Gene:Cyp2c6v1 / 293989 RGDID:619934 Length:490 Species:Rattus norvegicus


Alignment Length:484 Identity:156/484 - (32%)
Similarity:242/484 - (50%) Gaps:49/484 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    26 LLMVFLGLLALVTLLQWLVRNYRELRKLPPGPWGLPVIGYLLFMGSEKHTRFM-ELAKQYGSLFS 89
            ::::.|.|..|:.|..|  |......||||||..||:||.:..:..:..|:.: ..:|.||.:|:
  Rat     4 VMLLVLTLTCLILLSIW--RQSSGRGKLPPGPIPLPIIGNIFQLNVKNITQSLTSFSKVYGPVFT 66

  Fly    90 TRLGSQLTVVMSDYKMIRECF--RREEFTGRPDTPFMQTLN-GYGIINSTGKLWKDQRRFLHDKL 151
            ...|::.||::..|:.::|..  ..|||..|...|..:.:| ..||:.|.|..||:.|||....|
  Rat    67 LYFGTKPTVILHGYEAVKEALIDHGEEFAERGSFPVAEKINKDLGIVFSHGNRWKEIRRFTLTTL 131

  Fly   152 RQFGMTYMGNGKQQMQKRIMTEVHEFIGHLHASDGQPVDMSPVISVAVSNVICSLMMSTRFSIDD 216
            |..||     ||:.::.|:..|....:..|..::|.|.|.:.::..|..|||||::...||...|
  Rat   132 RNLGM-----GKRNIEDRVQEEARCLVEELRKTNGSPCDPTFILGCAPCNVICSIIFQNRFDYKD 191

  Fly   217 PKFRRFNFLIEEGMRLFGEIHT---------VDYIPTMQCFPSISTAKNKIAQNRAEMQRFYQDV 272
            ..|......:.|.|::.....|         :||.|         .:...:|:|...::.:....
  Rat   192 QDFLNLMEKLNENMKILSSPWTQFCSFFPVLIDYCP---------GSHTTLAKNVYHIRNYLLKK 247

  Fly   273 IDDHKRSFDPNNIRDLVDFYLCEIEKAKAEGTDAELFDGKNHE-------EQLVQVIIDLFSAGM 330
            |.:|:.|.|..|.||.:|:||.   |.|.|          ||.       |.|...:.|||.||.
  Rat   248 IKEHQESLDVTNPRDFIDYYLI---KWKQE----------NHNPHSEFTLENLSITVTDLFGAGT 299

  Fly   331 ETIKTTLLWINVFMLRNPKEMRRVQDELDQVVGRHRLPTIEDLQYLPITESTILESMRRSSIVPL 395
            ||..|||.:..:.:|:.|:...:||:|:|:|||:||.|.::|...:|.|::.|.|..|...::|.
  Rat   300 ETTSTTLRYALLLLLKCPEVTAKVQEEIDRVVGKHRSPCMQDRSRMPYTDAMIHEVQRFIDLIPT 364

  Fly   396 ATTHSPTRDVELNGYTIPAGSHVIPLINSVHMDPNLWEKPEEFRPSRFIDTEGKVRKPEYFIPFG 460
            ...|:.|.|::...|.||.|:.:|..::||..|...:..||.|.|..|:|..||.:|.:||:||.
  Rat   365 NLPHAVTCDIKFRNYLIPKGTTIITSLSSVLHDSKEFPDPEIFDPGHFLDGNGKFKKSDYFMPFS 429

  Fly   461 VGRRMCLGDVLARMELFLFFASFMHCFDI 489
            .|:|||.|:.|||||||||..:.:..|.:
  Rat   430 AGKRMCAGEGLARMELFLFLTTILQNFKL 458

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cyp18a1NP_523403.2 p450 54..517 CDD:278495 148/456 (32%)
Cyp2c6v1NP_001013926.2 CYP2C-like 61..485 CDD:410758 138/425 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BC78
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG45226
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000008
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X6
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
54.820

Return to query results.
Submit another query.