DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cyp18a1 and Cyp2c7

DIOPT Version :9

Sequence 1:NP_523403.2 Gene:Cyp18a1 / 32858 FlyBaseID:FBgn0010383 Length:538 Species:Drosophila melanogaster
Sequence 2:NP_058854.1 Gene:Cyp2c7 / 29298 RGDID:620379 Length:490 Species:Rattus norvegicus


Alignment Length:507 Identity:168/507 - (33%)
Similarity:267/507 - (52%) Gaps:40/507 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    27 LMVF--LGLLALVTLLQWLVRNYRELRKLPPGPWGLPVIGYLLFMG----SEKHTRFMELAKQYG 85
            |:.|  |.|.:|:.|..|  |.....|||||||..||:||..|.:.    |:..|:|   :|.||
  Rat     3 LVTFLVLTLSSLILLSLW--RQSSRRRKLPPGPTPLPIIGNFLQIDVKNISQSLTKF---SKTYG 62

  Fly    86 SLFSTRLGSQLTVVMSDYKMIRECF--RREEFTGRPDTPFMQTL-NGYGIINSTGKLWKDQRRFL 147
            .:|:..||||.||::..|:.|:|..  ..|:|:||...|..:.: .|:||:.|.|..||:.|||.
  Rat    63 PVFTLYLGSQPTVILHGYEAIKEALIDNGEKFSGRGSYPMNENVTKGFGIVFSNGNRWKEMRRFT 127

  Fly   148 HDKLRQFGMTYMGNGKQQMQKRIMTEVHEFIGHLHASDGQPVDMSPVISVAVSNVICSLMMSTRF 212
            ....|..|:     ||:.::.|:..|....:..|..:.|.|.|.|.:::.|..|||||:.....|
  Rat   128 IMNFRNLGI-----GKRNIEDRVQEEAQCLVEELRKTKGSPCDPSLILNCAPCNVICSITFQNHF 187

  Fly   213 SIDDPKFRRFNFLIEEGMRLFGEIHTVDYIPTMQ-C--FPSI----STAKNKIAQNRAEMQRFYQ 270
            ...|.:...|...:.|.:::...       |.|| |  |||:    ....:|||:|...|:.:..
  Rat   188 DYKDKEMLTFMEKVNENLKIMSS-------PWMQVCNSFPSLIDYFPGTHHKIAKNINYMKSYLL 245

  Fly   271 DVIDDHKRSFDPNNIRDLVDFYLCEIEKAKAEGTDAELFDGKNHEEQLVQVIIDLFSAGMETIKT 335
            ..|::|:.|.|..|.||.||:||  |::.:|...:...:.    .|.|...|:||..||.||:.|
  Rat   246 KKIEEHQESLDVTNPRDFVDYYL--IKQKQANNIEQSEYS----HENLTCSIMDLIGAGTETMST 304

  Fly   336 TLLWINVFMLRNPKEMRRVQDELDQVVGRHRLPTIEDLQYLPITESTILESMRRSSIVPLATTHS 400
            ||.:..:.:::.|....:||:|:|:|:||||.|.::|.:::|.|::.|.|..|..:.||....|:
  Rat   305 TLRYALLLLMKYPHVTAKVQEEIDRVIGRHRSPCMQDRKHMPYTDAMIHEVQRFINFVPTNLPHA 369

  Fly   401 PTRDVELNGYTIPAGSHVIPLINSVHMDPNLWEKPEEFRPSRFIDTEGKVRKPEYFIPFGVGRRM 465
            .|.|::...|.||.|:.|:..:.||..|...:..||.|.|..|:|..|..:|.:||:||..|:|.
  Rat   370 VTCDIKFRNYLIPKGTKVLTSLTSVLHDSKEFPNPEMFDPGHFLDENGNFKKSDYFLPFSAGKRA 434

  Fly   466 CLGDVLARMELFLFFASFMHCFDI-ALPEGQPLPSLKGNVGATITPESFKVC 516
            |:|:.||||:||||..:.:..|:: :|...:.:.::....|....|.::::|
  Rat   435 CVGEGLARMQLFLFLTTILQNFNLKSLVHPKDIDTMPVLNGFASLPPTYQLC 486

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cyp18a1NP_523403.2 p450 54..517 CDD:278495 157/478 (33%)
Cyp2c7NP_058854.1 p450 30..487 CDD:278495 157/478 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG45226
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000008
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X6
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
54.920

Return to query results.
Submit another query.