DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cyp18a1 and Cyp2b1

DIOPT Version :10

Sequence 1:NP_523403.2 Gene:Cyp18a1 / 32858 FlyBaseID:FBgn0010383 Length:538 Species:Drosophila melanogaster
Sequence 2:XP_038950984.1 Gene:Cyp2b1 / 24300 RGDID:2466 Length:517 Species:Rattus norvegicus


Alignment Length:32 Identity:12/32 - (37%)
Similarity:17/32 - (53%) Gaps:2/32 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly   416 IIECTAE--LLHNRTYLGQRDYNLEDDIYKNL 445
            |||..||  ..:||.|:.....:|.||..|::
  Rat   154 IIEQLAEEARAYNRIYVASIHPDLSDDDIKSV 185

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cyp18a1NP_523403.2 CYP306A1-like 85..515 CDD:410745 12/32 (38%)
Cyp2b1XP_038950984.1 CYP2B 88..512 CDD:410765 12/32 (38%)

Return to query results.
Submit another query.