DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cyp18a1 and cyp-33E3

DIOPT Version :9

Sequence 1:NP_523403.2 Gene:Cyp18a1 / 32858 FlyBaseID:FBgn0010383 Length:538 Species:Drosophila melanogaster
Sequence 2:NP_501471.1 Gene:cyp-33E3 / 185652 WormBaseID:WBGene00018333 Length:236 Species:Caenorhabditis elegans


Alignment Length:205 Identity:69/205 - (33%)
Similarity:108/205 - (52%) Gaps:26/205 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    23 AQHLLMVFLGLLALVTLLQWLVRNYRELRKLPPGPWGLPVIGYLLFMGSEK----HTRFMELAKQ 83
            |..|.::||.|...:         |.:.|.|||||..||.:|.||.: :||    :..:..|.:|
 Worm     4 ALSLALLFLYLFHFI---------YWKRRNLPPGPAPLPFVGNLLML-TEKVKPGYKLWDSLTQQ 58

  Fly    84 YGSLFSTRLGSQLTVVMSDYKMIRECFRRE--EFTGRPDTPF-MQTLNG-YGIINSTGKLWKDQR 144
            |||:|:..:.....|.::|:|:|::.|.::  .:.|||:.|. .:...| ||||::.|..|..||
 Worm    59 YGSVFTFWMAGLPMVFVTDWKLIKQYFIKDGGSYVGRPEFPLNTEVKKGPYGIIDAHGNRWIQQR 123

  Fly   145 RFLHDKLRQFGMTYMGNGKQQMQKRIMTEVHEFIGHLHASDGQPVDMSPVISVAVSNVICSLMMS 209
            ||....||.||:     ||..|:::|:|||...|..|..:.. .|||..|...::.::|.||:..
 Worm   124 RFALHVLRDFGL-----GKNIMEEKILTEVTVMIERLRKTIA-CVDMQNVFDTSIGSIINSLIFG 182

  Fly   210 TRFSIDDPKF 219
            .||  |:.:|
 Worm   183 YRF--DESEF 190

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cyp18a1NP_523403.2 p450 54..517 CDD:278495 61/174 (35%)
cyp-33E3NP_501471.1 p450 26..>186 CDD:299894 59/168 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BC78
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000008
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.