DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cyp18a1 and CYP2E1

DIOPT Version :9

Sequence 1:NP_523403.2 Gene:Cyp18a1 / 32858 FlyBaseID:FBgn0010383 Length:538 Species:Drosophila melanogaster
Sequence 2:NP_000764.1 Gene:CYP2E1 / 1571 HGNCID:2631 Length:493 Species:Homo sapiens


Alignment Length:511 Identity:172/511 - (33%)
Similarity:264/511 - (51%) Gaps:43/511 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    28 MVFLGLLALVTLLQW-----LVRNYRELR---KLPPGPWGLPVIGYLLFMGSEKHTR-FMELAKQ 83
            |..||:  .|.||.|     ||..:|::.   .|||||:.||:||.|..:..:...: |..||::
Human     1 MSALGV--TVALLVWAAFLLLVSMWRQVHSSWNLPPGPFPLPIIGNLFQLELKNIPKSFTRLAQR 63

  Fly    84 YGSLFSTRLGSQLTVVMSDYKMIRECF--RREEFTGRPDTPFMQTLNGYGIINSTGKLWKDQRRF 146
            :|.:|:..:|||..|||..||.::|..  .::||:||.|.|........|||.:.|..|||.|||
Human    64 FGPVFTLYVGSQRMVVMHGYKAVKEALLDYKDEFSGRGDLPAFHAHRDRGIIFNNGPTWKDIRRF 128

  Fly   147 LHDKLRQFGMTYMGNGKQQMQKRIMTEVHEFIGHLHASDGQPVDMSPVISVAVSNVICSLMMSTR 211
            ....||.:||     |||..:.||..|.|..:..|..:.|||.|.:.:|..|..|||..::....
Human   129 SLTTLRNYGM-----GKQGNESRIQREAHFLLEALRKTQGQPFDPTFLIGCAPCNVIADILFRKH 188

  Fly   212 FSIDDPKFRRFNFLIEEGMRLFGEIHTVDYIPTMQCFPS----ISTAKNKIAQNRAEMQRFYQDV 272
            |..:|.||.|..:|..|...|.    :..::.....|||    :..:..|:.:|.||::.:..:.
Human   189 FDYNDEKFLRLMYLFNENFHLL----STPWLQLYNNFPSFLHYLPGSHRKVIKNVAEVKEYVSER 249

  Fly   273 IDDHKRSFDPNNIRDLVDFYLCEIEKAKAEGTDAELFDGKNHEEQLVQVIIDLFSAGMETIKTTL 337
            :.:|.:|.|||..|||.|..|.|:||.|.........||      :...:.|||.||.||..|||
Human   250 VKEHHQSLDPNCPRDLTDCLLVEMEKEKHSAERLYTMDG------ITVTVADLFFAGTETTSTTL 308

  Fly   338 LWINVFMLRNPKEMRRVQDELDQVVGRHRLPTIEDLQYLPITESTILESMRRSSIVPLATTHSPT 402
            .:..:.:::.|:...::.:|:|:|:|..|:|.|:|.|.:|..::.:.|..|..::||....|..|
Human   309 RYGLLILMKYPEIEEKLHEEIDRVIGPSRIPAIKDRQEMPYMDAVVHEIQRFITLVPSNLPHEAT 373

  Fly   403 RDVELNGYTIPAGSHVIPLINSVHMDPNLWEKPEEFRPSRFIDTEGKVRKPEYFIPFGVGRRMCL 467
            ||....||.||.|:.|:|.::||..|...:..||:|:|..|::..||.:..:||.||..|:|:|.
Human   374 RDTIFRGYLIPKGTVVVPTLDSVLYDNQEFPDPEKFKPEHFLNENGKFKYSDYFKPFSTGKRVCA 438

  Fly   468 GDVLARMELFLFFASFMHCFDIALPEGQPLPSLKG------NVGATITPESFKVCL 517
            |:.||||||||...:.:..|::     :||...|.      ::|....|..:|:|:
Human   439 GEGLARMELFLLLCAILQHFNL-----KPLVDPKDIDLSPIHIGFGCIPPRYKLCV 489

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cyp18a1NP_523403.2 p450 54..517 CDD:278495 160/475 (34%)
CYP2E1NP_000764.1 p450 33..489 CDD:365848 160/475 (34%)
Substrate binding. /evidence=ECO:0000305 298..303 2/4 (50%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG45226
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000008
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X6
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
54.920

Return to query results.
Submit another query.