DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cyp18a1 and CYP2B6

DIOPT Version :9

Sequence 1:NP_523403.2 Gene:Cyp18a1 / 32858 FlyBaseID:FBgn0010383 Length:538 Species:Drosophila melanogaster
Sequence 2:NP_000758.1 Gene:CYP2B6 / 1555 HGNCID:2615 Length:491 Species:Homo sapiens


Alignment Length:482 Identity:160/482 - (33%)
Similarity:249/482 - (51%) Gaps:38/482 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    27 LMVFLGLLALVTLLQWLVRNYRELR-KLPPGPWGLPVIGYLLFMGSEKHTR-FMELAKQYGSLFS 89
            |.|.|.|..|..||..||:.:.... :|||||..||::|.||.|......: |:...::||.:|:
Human     3 LSVLLFLALLTGLLLLLVQRHPNTHDRLPPGPRPLPLLGNLLQMDRRGLLKSFLRFREKYGDVFT 67

  Fly    90 TRLGSQLTVVMSDYKMIRECF--RREEFTGRPD----TPFMQTLNGYGIINSTGKLWKDQRRFLH 148
            ..||.:..|::...:.|||..  :.|.|:||..    .||.:   |||:|.:.|..||..|||..
Human    68 VHLGPRPVVMLCGVEAIREALVDKAEAFSGRGKIAMVDPFFR---GYGVIFANGNRWKVLRRFSV 129

  Fly   149 DKLRQFGMTYMGNGKQQMQKRIMTEVHEFIGHLHASDGQPVDMSPVISVAVSNVICSLMMSTRFS 213
            ..:|.|||     ||:.:::||..|....|..|..|.|..:|.:.:.....:|:|||::...||.
Human   130 TTMRDFGM-----GKRSVEERIQEEAQCLIEELRKSKGALMDPTFLFQSITANIICSIVFGKRFH 189

  Fly   214 IDDPKFRRFNFLIEEGMRL----FGEIHTVDYIPTMQCFPSISTAKNKIAQNRAEMQRFYQDVID 274
            ..|.:|.:...|..:...|    ||::..: :...::.||.   |..::.:|..|:..:....::
Human   190 YQDQEFLKMLNLFYQTFSLISSVFGQLFEL-FSGFLKYFPG---AHRQVYKNLQEINAYIGHSVE 250

  Fly   275 DHKRSFDPNNIRDLVDFYLCEIEKAKAEGTDAELFDGKNHEEQLVQVI----IDLFSAGMETIKT 335
            .|:.:.||:..:||:|.||..:||.|:..          |.|...|.:    :.||.||.||..|
Human   251 KHRETLDPSAPKDLIDTYLLHMEKEKSNA----------HSEFSHQNLNLNTLSLFFAGTETTST 305

  Fly   336 TLLWINVFMLRNPKEMRRVQDELDQVVGRHRLPTIEDLQYLPITESTILESMRRSSIVPLATTHS 400
            ||.:..:.||:.|....||..|::||:|.||.|.:.|...:|.||:.|.|..|.|.::|:...|.
Human   306 TLRYGFLLMLKYPHVAERVYREIEQVIGPHRPPELHDRAKMPYTEAVIYEIQRFSDLLPMGVPHI 370

  Fly   401 PTRDVELNGYTIPAGSHVIPLINSVHMDPNLWEKPEEFRPSRFIDTEGKVRKPEYFIPFGVGRRM 465
            .|:.....||.||..:.|..::::...||:.:|||:.|.|..|:|..|.::|.|.||||.:|:|:
Human   371 VTQHTSFRGYIIPKDTEVFLILSTALHDPHYFEKPDAFNPDHFLDANGALKKTEAFIPFSLGKRI 435

  Fly   466 CLGDVLARMELFLFFASFMHCFDIALP 492
            |||:.:||.||||||.:.:..|.:|.|
Human   436 CLGEGIARAELFLFFTTILQNFSMASP 462

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cyp18a1NP_523403.2 p450 54..517 CDD:278495 150/454 (33%)
CYP2B6NP_000758.1 p450 42..488 CDD:278495 143/443 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BC78
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG45226
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000008
OrthoInspector 1 1.000 - - otm41747
orthoMCL 1 0.900 - - OOG6_100036
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X6
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
76.720

Return to query results.
Submit another query.