DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cyp18a1 and LOC100361547

DIOPT Version :9

Sequence 1:NP_523403.2 Gene:Cyp18a1 / 32858 FlyBaseID:FBgn0010383 Length:538 Species:Drosophila melanogaster
Sequence 2:XP_038957345.1 Gene:LOC100361547 / 100361547 RGDID:2319920 Length:113 Species:Rattus norvegicus


Alignment Length:96 Identity:26/96 - (27%)
Similarity:41/96 - (42%) Gaps:12/96 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly   151 LRQFGMTYMGNGKQQMQKRIMTEVHEFIGHLHASDGQPVDMSPVISVAVSNVICSLMMSTRFSID 215
            ||..||     ||:.::.|:..|....:..|..:.|.|.|.|.:::.|..|||||:.....|...
  Rat     3 LRNLGM-----GKRNIEDRVQEEAQRLVEELRKTKGSPCDPSFILNCAPCNVICSITFQNHFDYK 62

  Fly   216 DPKFRRFNFLIEEGMRLFGEIHTVDYIPTMQ 246
            |.:...|...:.|.:::...       |.||
  Rat    63 DKEILTFMEKVNENVKIMSS-------PRMQ 86

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cyp18a1NP_523403.2 p450 54..517 CDD:278495 26/96 (27%)
LOC100361547XP_038957345.1 cytochrome_P450 1..>91 CDD:425388 26/96 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG45226
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000008
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X6
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
44.010

Return to query results.
Submit another query.