DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment phm and CYP71B32

DIOPT Version :9

Sequence 1:NP_001285414.1 Gene:phm / 32857 FlyBaseID:FBgn0004959 Length:574 Species:Drosophila melanogaster
Sequence 2:NP_680127.1 Gene:CYP71B32 / 824498 AraportID:AT3G53305 Length:338 Species:Arabidopsis thaliana


Alignment Length:296 Identity:70/296 - (23%)
Similarity:109/296 - (36%) Gaps:73/296 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly   284 EKQKVFKELQEQ------KRLQRQLEKEQLRQSKEADPS------------QEQSEADEDDEESD 330
            :|.|.|:.::|:      |::....:.:.|...::|..|            |...:.|..|.:..
plant    73 KKHKSFRYIREEEGDLLVKKISNSAQTQTLIDLRKASFSFTAGTIFRLAFGQNFHQCDFMDMDRL 137

  Fly   331 EEDTYEPE---CILEHFLAVRDTDSQLYCDDQLRHLLADLFGAGVDTSLATLRWFLLYLAREQRC 392
            ||...|.|   ||    ||:.|     :....|..|:..:.|.|...|               .|
plant   138 EELVLEAETNGCI----LALTD-----FLPTGLGWLVDRISGCGFGGS---------------EC 178

  Fly   393 QRRLHELLLPLGPSPTLEELEPLAYLRACISETMRIRSVVPLGIPHGCKENFVVGDYFIKGGSMI 457
            ... |            .:|:.:.||...|.||.|:....||.:|.....:..:..|.|...::|
plant   179 GNN-H------------NDLQKVEYLNMVIKETFRLHPPSPLLLPRETMSDIEIQGYHIPKNALI 230

  Fly   458 VCSEWAIHMDPVAFPEPEEFRPERFLTADGAYQAPP-QFIPFSSGYRMCPGEEMARMILTLFTGR 521
            ..:.:.|..|...:.     .|||||.....|:... :.:||.:|.|.|||..:...||.|....
plant   231 RINTYTIGRDLKCWS-----NPERFLNTSINYKGQDYKLLPFGAGRRSCPGMNLGITILELGLLN 290

  Fly   522 ILRRFHLELPSG---TEVDMAGESG-----ITLTPT 549
            ||..|....|:|   .::||. |:|     :.|.||
plant   291 ILYFFDWSFPNGMTIEDIDME-ENGALNKTLELIPT 325

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
phmNP_001285414.1 p450 49..555 CDD:278495 70/296 (24%)
CYP71B32NP_680127.1 p450 3..311 CDD:299894 64/279 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 157 1.000 Inparanoid score I1659
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X6
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
33.050

Return to query results.
Submit another query.