DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6696 and Tnfaip6

DIOPT Version :9

Sequence 1:NP_573318.1 Gene:CG6696 / 32856 FlyBaseID:FBgn0030947 Length:324 Species:Drosophila melanogaster
Sequence 2:NP_445834.1 Gene:Tnfaip6 / 84397 RGDID:621359 Length:275 Species:Rattus norvegicus


Alignment Length:287 Identity:63/287 - (21%)
Similarity:89/287 - (31%) Gaps:110/287 - (38%)


- Green bases have known domain annotations that are detailed below.


  Fly    76 IWEHC-------GLFEGDIML-------HRELLRNGLLNERLTWPEAAVPFYIDPQDFNANQTMV 126
            :||..       |:|...|.|       ||| .|.|  ..:||:.||                  
  Rat    11 LWEEAHGWGFKNGIFHNSIWLEQAAGVYHRE-ARAG--RYKLTYAEA------------------ 54

  Fly   127 ILKAFKEYHDRTCIRFRPYEQGDKHWLLIKGNYSGC---WSSVGRRSGGQVLNLNTPKCVTHGVV 188
              ||..||.......::..|...|.      .:..|   |.:.||  .|..:....|.|      
  Rat    55 --KAVCEYEGGRLATYKQLEAARKI------GFHVCAAGWMAKGR--VGYPIVKPGPNC------ 103

  Fly   189 VHELLHALGFYHQQSATERDEY-VKINWENILDGHAHNFN-KYARTHITN---------FGVEYD 242
                    ||    ..|...:| :::|.....|.:.:|.| |......|:         |..|||
  Rat   104 --------GF----GKTGIIDYGIRLNRSERWDAYCYNPNAKECGGVFTDPKRIFKSPGFPNEYD 156

  Fly   243 YQSVMHYSSRAFSKNGKATIEPLDPYASLGQRRGLS--DKDVSKLNEMYEQDCSEDYLLNFDRF- 304
            ...|.::..|                ...|||..||  |.|:.     ::..|..||:..:|.: 
  Rat   157 DNQVCYWHIR----------------LKYGQRIHLSFLDFDLE-----HDPGCLADYVEIYDSYD 200

  Fly   305 ------GNYI-DELLD--YFQGNIQDL 322
                  |.|. |||.:  ...||:..|
  Rat   201 DVHGFVGRYCGDELPEDIISTGNVMTL 227

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6696NP_573318.1 Astacin 104..295 CDD:279708 40/206 (19%)
ZnMc_astacin_like 110..289 CDD:239807 36/194 (19%)
Tnfaip6NP_445834.1 Link_domain_TSG_6_like 36..128 CDD:239592 28/140 (20%)
CUB 135..244 CDD:395345 26/114 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3714
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.