DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6696 and Bmp1

DIOPT Version :9

Sequence 1:NP_573318.1 Gene:CG6696 / 32856 FlyBaseID:FBgn0030947 Length:324 Species:Drosophila melanogaster
Sequence 2:NP_112613.1 Gene:Bmp1 / 83470 RGDID:620739 Length:990 Species:Rattus norvegicus


Alignment Length:217 Identity:72/217 - (33%)
Similarity:113/217 - (52%) Gaps:20/217 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly   101 ERLTWPEAAVPFYIDPQDFNANQTMVILKAFKEYHDRTCIRFRPYEQGDK-HWLLIKGNYSGCWS 164
            ||: ||:..:||.|. .:|..:|..|..:|.:.:...||:.|  .|:.|: .:::......||.|
  Rat   131 ERV-WPDGVIPFVIG-GNFTGSQRAVFRQAMRHWEKHTCVTF--LERTDEDSYIVFTYRPCGCCS 191

  Fly   165 SVGRRSGG-QVLNLNTPKCVTHGVVVHELLHALGFYHQQSATERDEYVKINWENILDGHAHNFNK 228
            .||||.|| |.:::. ..|...|:|||||.|.:||:|:.:..:||.:|.|..|||..|..:||.|
  Rat   192 YVGRRGGGPQAISIG-KNCDKFGIVVHELGHVIGFWHEHTRPDRDRHVSIVRENIQPGQEYNFLK 255

  Fly   229 YARTHITNFGVEYDYQSVMHYSSRAFSKN-------GKATIEPLDPYASLGQRRGLSDKDVSKLN 286
            .....:.:.|..||:.|:|||:...||:.       .|..:..:.|  |:|||..||..|:::..
  Rat   256 MEVQEVESLGETYDFDSIMHYARNTFSRGIFLDTIVPKYEVNGVKP--SIGQRTRLSKGDIAQAR 318

  Fly   287 EMYE-QDCSEDYLLNFDRFGNY 307
            ::|: ..|.|...   |..||:
  Rat   319 KLYKCPACGETLQ---DSTGNF 337

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6696NP_573318.1 Astacin 104..295 CDD:279708 66/200 (33%)
ZnMc_astacin_like 110..289 CDD:239807 62/187 (33%)
Bmp1NP_112613.1 ZnMc_BMP1_TLD 125..324 CDD:239808 67/199 (34%)
Astacin 132..325 CDD:279708 66/199 (33%)
CUB 326..435 CDD:278839 5/15 (33%)
CUB 439..548 CDD:278839
FXa_inhibition 559..591 CDD:291342
CUB 595..704 CDD:278839
FXa_inhibition 711..746 CDD:291342
CUB 751..860 CDD:278839
CUB 864..977 CDD:278839
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3714
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.