DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6696 and LOC797085

DIOPT Version :9

Sequence 1:NP_573318.1 Gene:CG6696 / 32856 FlyBaseID:FBgn0030947 Length:324 Species:Drosophila melanogaster
Sequence 2:NP_001373298.1 Gene:LOC797085 / 797085 -ID:- Length:285 Species:Danio rerio


Alignment Length:229 Identity:82/229 - (35%)
Similarity:115/229 - (50%) Gaps:28/229 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    71 DSDTNIWEHCGLFEGDIMLHRELLRNGLLNERLTWP----EAAVPFYIDP--QDFNANQTMVILK 129
            |||    |...|.|.||:...:  ||.  ...| ||    |.:||:.|..  :|    :|..||.
Zfish    77 DSD----EGYALEEEDIIPQTD--RNA--GNHL-WPEKDGEVSVPYSIASGLED----KTGHILA 128

  Fly   130 AFKEYHDRTCIRFRPYEQGDKHWLLIKGNYSGCWSSVGRRSGGQVLNLNTPKCVTHGVVVHELLH 194
            |.|....:||::|. :...::.:|..|.:.. |.|.||...|.|.: |..||| ..|.:.||:||
Zfish   129 ALKMVSKKTCVKFH-HHTTEEDYLHFKPDRM-CASLVGCAGGEQPI-LVGPKC-NAGNICHEILH 189

  Fly   195 ALGFYHQQSATERDEYVKINWENILDGHAHNFN-KYARTHITNFGVEYDYQSVMHYSSRAFSKNG 258
            :||.||:.|..:||:|:.|.::||:.|...||. |...|    .|:|||..|::||....||:||
Zfish   190 SLGLYHEHSRPDRDKYITILYDNIMPGKESNFKVKKGNT----LGLEYDLDSILHYGDDCFSRNG 250

  Fly   259 KATIEPLDPYASLGQRRGLSDKDVSKLNEMYEQD 292
            ..||.|......:|||..:|..||.:|..:|..|
Zfish   251 NHTIIPKKKGVKIGQRTHMSVLDVERLRRLYHCD 284

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6696NP_573318.1 Astacin 104..295 CDD:279708 71/196 (36%)
ZnMc_astacin_like 110..289 CDD:239807 66/181 (36%)
LOC797085NP_001373298.1 ZnMc_astacin_like 111..281 CDD:239807 66/181 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D472790at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.