DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6696 and he1.3

DIOPT Version :9

Sequence 1:NP_573318.1 Gene:CG6696 / 32856 FlyBaseID:FBgn0030947 Length:324 Species:Drosophila melanogaster
Sequence 2:NP_001091658.1 Gene:he1.3 / 792176 ZFINID:ZDB-GENE-040518-1 Length:271 Species:Danio rerio


Alignment Length:233 Identity:87/233 - (37%)
Similarity:128/233 - (54%) Gaps:17/233 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    73 DTNIWEHCGLFEGDIMLHRELLRNGLL--NERLTWPEAAVPF----YIDPQDFNANQTMVILKAF 131
            :||......|.||| ||:.: .||.|:  |....|.:.:..|    ||...:::|.:..||.||.
Zfish    44 ETNKGSSRRLIEGD-MLYPQ-TRNALVCGNNNCFWKKNSSNFVEVPYIVSSEYSATEISVIQKAM 106

  Fly   132 KEYHDRTCIRFRP-YEQGDKHWLLIKGNYSGCWSSVGRRSGGQVLNLNTPKCVTHGVVVHELLHA 195
            ...|::|||||.| ..|.|  ::.|: |..||::.:|:..|.|:::|....||.|.:|.|||.||
Zfish   107 SGIHNKTCIRFVPRISQTD--YISIE-NQDGCFAFIGKNGGKQLVSLRKKGCVYHSIVQHELNHA 168

  Fly   196 LGFYHQQSATERDEYVKINWENILDGHAHNFNKYARTHITNFGVEYDYQSVMHYSSRAFSK-NGK 259
            |||||:...::||.|:.|:||.|......||.| ..|:..|  ..|||.|:|||...||:. .||
Zfish   169 LGFYHEHVRSDRDSYITIHWEYIATNEIRNFMK-KNTNSQN--TTYDYGSIMHYGKTAFTTVKGK 230

  Fly   260 ATIEPL-DPYASLGQRRGLSDKDVSKLNEMYEQDCSED 296
            .|:.|. |....:|:.:.:||.|:.::|.||..:.|:|
Zfish   231 ETMTPYPDETVPIGKAKEMSDIDILRINMMYSCNISDD 268

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6696NP_573318.1 Astacin 104..295 CDD:279708 73/197 (37%)
ZnMc_astacin_like 110..289 CDD:239807 70/185 (38%)
he1.3NP_001091658.1 ZnMc 82..263 CDD:294052 72/186 (39%)
Astacin 86..264 CDD:279708 71/183 (39%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3714
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D472790at33208
OrthoFinder 1 1.000 - - FOG0000240
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.