DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6696 and c6ast1

DIOPT Version :9

Sequence 1:NP_573318.1 Gene:CG6696 / 32856 FlyBaseID:FBgn0030947 Length:324 Species:Drosophila melanogaster
Sequence 2:NP_001036784.1 Gene:c6ast1 / 751088 ZFINID:ZDB-GENE-070621-1 Length:260 Species:Danio rerio


Alignment Length:291 Identity:97/291 - (33%)
Similarity:151/291 - (51%) Gaps:45/291 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 LICFWSALALALSATLEASTPATRKALLRARPAVPPAARWGANMQMLRRHNSPAFNFWTEDSDTN 75
            :|||..:...|.|.|:|....:.  :.|..||:                      ||..|:.|  
Zfish     6 VICFLLSSFEAQSRTIEQDIISA--SALMERPS----------------------NFAGEELD-- 44

  Fly    76 IWEHCGLFEGDIMLHREL-LRNGLLNERLTWP-----EAAVPFYIDPQDFNANQTMVILKAFKEY 134
              |...:| |||.:...| :......:...||     :..|| ||...:::..:..||.:.|:..
Zfish    45 --EPSIMF-GDIAVGTPLDITAPCTGQSCKWPLSSNGKVFVP-YIISDEYSTQEKDVIFQGFRSL 105

  Fly   135 HDRTCIRFRPYEQGDKHWLLIKGNYSGCWSSVGRRSGGQVLNLNTPKCVTHGVVVHELLHALGFY 199
            ...||:|||| ....:.::.|:.| |||:|.||||:|||.::|:...|:...:|.|||||.|||:
Zfish   106 EKSTCVRFRP-RTTQRDYINIEPN-SGCYSFVGRRTGGQTVSLDHDGCIKLNIVQHELLHTLGFH 168

  Fly   200 HQQSATERDEYVKINWENILDGHAHNFNKYARTHITNFGVEYDYQSVMHYSSRAFSKNGKATIEP 264
            |:.:.::||.:|:|.::||:.|...||:| .:|:  |....|||.|||||...|||||.:|||.|
Zfish   169 HEHNRSDRDSHVQIVYKNIIPGQERNFDK-IKTN--NLETAYDYSSVMHYGRFAFSKNKEATIVP 230

  Fly   265 L-DPYASLGQRRGLSDKDVSKLNEMYEQDCS 294
            : |...::|:.:.:|..|:.::|.:|   ||
Zfish   231 IPDSGVTIGRAKRMSSNDILRINRLY---CS 258

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6696NP_573318.1 Astacin 104..295 CDD:279708 77/197 (39%)
ZnMc_astacin_like 110..289 CDD:239807 72/179 (40%)
c6ast1NP_001036784.1 Astacin 71..259 CDD:279708 77/197 (39%)
ZnMc_hatching_enzyme 77..257 CDD:239810 73/188 (39%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170595464
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D472790at33208
OrthoFinder 1 1.000 - - FOG0000240
OrthoInspector 1 1.000 - - mtm6586
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10127
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X245
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
87.950

Return to query results.
Submit another query.