DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6696 and TLL2

DIOPT Version :9

Sequence 1:NP_573318.1 Gene:CG6696 / 32856 FlyBaseID:FBgn0030947 Length:324 Species:Drosophila melanogaster
Sequence 2:NP_036597.1 Gene:TLL2 / 7093 HGNCID:11844 Length:1015 Species:Homo sapiens


Alignment Length:223 Identity:69/223 - (30%)
Similarity:113/223 - (50%) Gaps:32/223 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly   101 ERLTWPEAAVPFYIDPQDFNANQTMVILKAFKEYHDRTCIRFRPYEQGDKH-WLLIKGNYSGCWS 164
            ||: ||...:| |:...:|..:|..:..:|.:.:...||:.|  .|:.|:. :::......||.|
Human   156 ERI-WPGGVIP-YVIGGNFTGSQRAIFKQAMRHWEKHTCVTF--IERTDEESFIVFSYRTCGCCS 216

  Fly   165 SVGRRSGG-QVLNLNTPKCVTHGVVVHELLHALGFYHQQSATERDEYVKINWENILDGHAHNFNK 228
            .||||.|| |.:::. ..|...|:|.|||.|.:||:|:.:..:||::|.|..|||..|..:||.|
Human   217 YVGRRGGGPQAISIG-KNCDKFGIVAHELGHVVGFWHEHTRPDRDQHVTIIRENIQPGQEYNFLK 280

  Fly   229 YARTHITNFGVEYDYQSVMHYSSRAFSK-------------NGKATIEPLDPYASLGQRRGLSDK 280
            .....:::.|..||:.|:|||:...||:             ||   :.|     ::|||..||..
Human   281 MEAGEVSSLGETYDFDSIMHYARNTFSRGVFLDTILPRQDDNG---VRP-----TIGQRVRLSQG 337

  Fly   281 DVSKLNEMYE-QDCSEDYLLNFDRFGNY 307
            |:::..::|: ..|.|...   |..||:
Human   338 DIAQARKLYKCPACGETLQ---DTTGNF 362

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6696NP_573318.1 Astacin 104..295 CDD:279708 63/206 (31%)
ZnMc_astacin_like 110..289 CDD:239807 59/193 (31%)
TLL2NP_036597.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 24..49
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 88..130
ZnMc_BMP1_TLD 150..349 CDD:239808 64/205 (31%)
Astacin 157..350 CDD:279708 63/205 (31%)
CUB 351..460 CDD:278839 5/15 (33%)
CUB 464..573 CDD:278839
FXa_inhibition 584..616 CDD:291342
CUB 620..729 CDD:278839
FXa_inhibition 736..771 CDD:291342
CUB 776..885 CDD:278839
CUB 889..1002 CDD:278839
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3714
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.