DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6696 and tnfaip6

DIOPT Version :9

Sequence 1:NP_573318.1 Gene:CG6696 / 32856 FlyBaseID:FBgn0030947 Length:324 Species:Drosophila melanogaster
Sequence 2:NP_001035333.2 Gene:tnfaip6 / 678516 ZFINID:ZDB-GENE-060421-2654 Length:271 Species:Danio rerio


Alignment Length:310 Identity:57/310 - (18%)
Similarity:89/310 - (28%) Gaps:141/310 - (45%)


- Green bases have known domain annotations that are detailed below.


  Fly    79 HCGL--------FEGDIMLHREL----LRNGLLNERLTWPEAAVPFYIDPQDFNANQTMVILKAF 131
            ||||        ..|.:::.:|.    .:||:|:..:...:||..::.:.:......|....||.
Zfish     3 HCGLRAMRALTAVFGVLIVLKETEAWGYKNGILHNSIWLEQAAGVYHRESRKGRYQLTYKEAKAV 67

  Fly   132 KEYHDRTCIRFRPYEQGDK---H-----WL--------LIK-GNYSG------------------ 161
            ..:...|...|...|...:   |     ||        ::| |:..|                  
Zfish    68 CNFEGGTLATFDQLEAARQIGFHVCAAGWLDKGRVGYPIVKAGSNCGFGKVGIIDYGYRLNKSER 132

  Fly   162 ----CWSSVGRRSGGQVLNLNTPKCVTHGVVVH----ELLHALGFYHQQSATERDEYVKINWENI 218
                |::.|.:..||                ||    ::|.:.|:        .|||..   |.|
Zfish   133 WDVYCYNPVAKECGG----------------VHTDPEKVLVSPGY--------PDEYQD---EQI 170

  Fly   219 LDGHAH-NFNKYARTHITNFGVEYDYQSVMHYSSRAFSKNGKATIEPLDPYASLGQRRGLSDKDV 282
            ...|.. .|....|.|..:|.:|.|                                        
Zfish   171 CYWHIRVRFGHRIRLHFLDFDIEED---------------------------------------- 195

  Fly   283 SKLNEMYEQDCSEDYLLNFDRF-------GNYI-DELLDYF--QGNIQDL 322
                    .||..|:|..:|.:       |.|. |:|.|.|  .||:..|
Zfish   196 --------TDCLSDHLEIYDSYDDVSGFVGRYCGDQLPDDFISTGNVMTL 237

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6696NP_573318.1 Astacin 104..295 CDD:279708 36/234 (15%)
ZnMc_astacin_like 110..289 CDD:239807 32/222 (14%)
tnfaip6NP_001035333.2 Link_domain_TSG_6_like 46..138 CDD:239592 12/91 (13%)
CUB 145..254 CDD:278839 32/168 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3714
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.