DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6696 and BMP1

DIOPT Version :10

Sequence 1:NP_573318.1 Gene:CG6696 / 32856 FlyBaseID:FBgn0030947 Length:324 Species:Drosophila melanogaster
Sequence 2:NP_006120.1 Gene:BMP1 / 649 HGNCID:1067 Length:986 Species:Homo sapiens


Alignment Length:240 Identity:76/240 - (31%)
Similarity:119/240 - (49%) Gaps:27/240 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    80 CGLFEGDIMLHRELLRNGLLN--ERLTWPEAAVPFYIDPQDFNANQTMVILKAFKEYHDRTCIRF 142
            ||.:.|     |...|....:  ||: ||:..:||.|. .:|..:|..|..:|.:.:...||:.|
Human   109 CGRWRG-----RSRSRRAATSRPERV-WPDGVIPFVIG-GNFTGSQRAVFRQAMRHWEKHTCVTF 166

  Fly   143 RPYEQGDK-HWLLIKGNYSGCWSSVGRRSGG-QVLNLNTPKCVTHGVVVHELLHALGFYHQQSAT 205
              .|:.|: .:::......||.|.||||.|| |.:::. ..|...|:|||||.|.:||:|:.:..
Human   167 --LERTDEDSYIVFTYRPCGCCSYVGRRGGGPQAISIG-KNCDKFGIVVHELGHVVGFWHEHTRP 228

  Fly   206 ERDEYVKINWENILDGHAHNFNKYARTHITNFGVEYDYQSVMHYSSRAFSKN-------GKATIE 263
            :||.:|.|..|||..|..:||.|.....:.:.|..||:.|:|||:...||:.       .|..:.
Human   229 DRDRHVSIVRENIQPGQEYNFLKMEPQEVESLGETYDFDSIMHYARNTFSRGIFLDTIVPKYEVN 293

  Fly   264 PLDPYASLGQRRGLSDKDVSKLNEMYE-QDCSEDYLLNFDRFGNY 307
            .:.|  .:|||..||..|:::..::|: ..|.|...   |..||:
Human   294 GVKP--PIGQRTRLSKGDIAQARKLYKCPACGETLQ---DSTGNF 333

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6696NP_573318.1 ZnMc_astacin_like 110..289 CDD:239807 61/187 (33%)
BMP1NP_006120.1 ZnMc_BMP1_TLD 121..320 CDD:239808 66/205 (32%)
CUB 322..431 CDD:395345 5/15 (33%)
CUB 435..544 CDD:395345
FXa_inhibition 555..587 CDD:464251
CUB 591..700 CDD:395345
FXa_inhibition 707..742 CDD:464251
CUB 747..856 CDD:395345
CUB 860..973 CDD:395345
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.