DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6696 and astl2c

DIOPT Version :9

Sequence 1:NP_573318.1 Gene:CG6696 / 32856 FlyBaseID:FBgn0030947 Length:324 Species:Drosophila melanogaster
Sequence 2:NP_001037864.1 Gene:astl2c / 594901 XenbaseID:XB-GENE-6449741 Length:496 Species:Xenopus tropicalis


Alignment Length:221 Identity:83/221 - (37%)
Similarity:125/221 - (56%) Gaps:18/221 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    84 EGDIMLHRELLRNGLLNERLTWPEAA-----VPFYIDPQDFNANQTMVILKAFKEYHDRTCIRFR 143
            :|||.  .:..|:.:..:...||:.:     ||:.|. .|::.|:..:|:.|.:|:...||::|.
 Frog    60 QGDIA--HKFSRSAINCKECLWPKDSNGIVNVPYTIS-SDYSQNEASLIMAAMQEFATLTCVQFI 121

  Fly   144 PYEQGDKHWLLIKGNYSGCWSSVGRRSGGQVLNLNTPKCVTHGVVVHELLHALGFYHQQSATERD 208
            |  |.|:...:......||||.:|...|.|.::|....|:.:||:.|||.|.|||.|:.|.::||
 Frog   122 P--QTDEDDYIAIQPLDGCWSYIGVNGGAQQVSLGKGGCIYYGVIQHELNHVLGFVHEHSRSDRD 184

  Fly   209 EYVKINWENILDGHAHNFNKYARTHITNFGVEYDYQSVMHYSSRAFSK-NGKATIEPLDPYAS-- 270
            .||.||::.|...:...|:|   ....|.|:||||.|||||...::|. .||.||.|: |.|:  
 Frog   185 NYVHINYQYISPDNIAFFDK---KDTDNLGLEYDYSSVMHYPGYSYSNTTGKNTIVPI-PNANVP 245

  Fly   271 LGQRRGLSDKDVSKLNEMYEQD-CSE 295
            :|||.|||..||||:|.:|:.| ||:
 Frog   246 IGQRYGLSTLDVSKINRLYQCDVCSK 271

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6696NP_573318.1 Astacin 104..295 CDD:279708 78/199 (39%)
ZnMc_astacin_like 110..289 CDD:239807 73/181 (40%)
astl2cNP_001037864.1 ZnMc_hatching_enzyme 84..266 CDD:239810 74/188 (39%)
Astacin 89..266 CDD:279708 74/183 (40%)
CUB 270..380 CDD:238001 1/2 (50%)
CUB 383..495 CDD:238001
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 156 1.000 Domainoid score I4121
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 160 1.000 Inparanoid score I4140
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - mtm9530
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
44.050

Return to query results.
Submit another query.